KEGG   Escherichia coli K-12 MG1655: b0029Help
Entry
b0029             CDS       T00007                                 

Gene name
ispH
Definition
(RefSeq) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, 4Fe-4S protein
  KO
K03527  
4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    b0029 (ispH)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     b0029 (ispH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
26277..27227
Genome map
AA seq 316 aa AA seqDB search
MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRERGAIFIEQI
SEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIG
HAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDA
LRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGK
RAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQQLGGGEAIPLEGREENI
VFEVPKELRVDIREVD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcctgttggccaacccgcgtggtttttgtgccggggtagaccgcgctatcagc
attgttgaaaacgcgctggccatttacggcgcaccgatatatgtccgtcacgaagtggta
cataaccgctatgtggtcgatagcttgcgtgagcgtggggctatctttattgagcagatt
agcgaagtaccggacggcgcgatcctgattttctccgcacacggtgtttctcaggcggta
cgtaacgaagcaaaaagtcgcgatttgacggtgtttgatgccacctgtccgctggtgacc
aaagtgcatatggaagtcgcccgcgccagtcgccgtggcgaagaatctattctcatcggt
cacgccgggcacccggaagtggaagggacaatgggccagtacagtaacccggaaggggga
atgtatctggtcgaatcgccggacgatgtgtggaaactgacggtcaaaaacgaagagaag
ctctcctttatgacccagaccacgctgtcggtggatgacacgtctgatgtgatcgacgcg
ctgcgtaaacgcttcccgaaaattgtcggtccgcgcaaagatgacatctgctacgccacg
actaaccgtcaggaagcggtacgcgccctggcagaacaggcggaagttgtgttggtggtc
ggttcgaaaaactcctccaactccaaccgtctggcggagctggcccagcgtatgggcaaa
cgcgcgtttttgattgacgatgcgaaagacatccaggaagagtgggtgaaagaggttaaa
tgcgtcggcgtgactgcgggcgcatcggctccggatattctggtgcagaatgtggtggca
cgtttgcagcagctgggcggtggtgaagccattccgctggaaggccgtgaagaaaacatt
gttttcgaagtgccgaaagagctgcgtgtcgatattcgtgaagtcgattaa

DBGET integrated database retrieval system