KEGG   Escherichia coli K-12 MG1655: b0031Help
Entry
b0031             CDS       T00007                                 

Gene name
dapB
Definition
(RefSeq) dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00261  Monobactam biosynthesis
eco00300  Lysine biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01230  Biosynthesis of amino acids
Module
eco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    b0031 (dapB)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    b0031 (dapB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     b0031 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N
Motif
Other DBs
NCBI-GeneID: 944762
NCBI-ProteinID: NP_414572
Pasteur: dapB
RegulonDB: ECK120000200
ECOCYC: EG10206
ASAP: ABE-0000112
UniProt: P04036
Structure
PDB: 

Jmol
Position
28374..29195
Genome map
AA seq 273 aa AA seqDB search
MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV
TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD
IAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAH
ALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSR
MTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatgcaaacatccgcgttgccatcgcgggagccggggggcgtatgggccgccag
ttgattcaggcggcgctggcattagagggcgtgcagttgggcgctgcgctggagcgtgaa
ggatcttctttactgggcagcgacgccggtgagctggccggagccgggaaaacaggcgtt
accgtgcaaagcagcctcgatgcggtaaaagatgattttgatgtgtttatcgattttacc
cgtccggaaggtacgctgaaccatctcgctttttgtcgccagcatggcaaagggatggtg
atcggcactacggggtttgacgaagccggtaaacaagcaattcgtgacgccgctgccgat
attgcgattgtctttgctgccaattttagcgttggcgttaacgtcatgcttaagctgctg
gagaaagcagccaaagtgatgggtgactacaccgatatcgaaattattgaagcacatcat
agacataaagttgatgcgccgtcaggcaccgcactggcaatgggagaggcgatcgcccac
gcccttgataaagatctgaaagattgcgcggtctacagtcgtgaaggccacaccggtgaa
cgtgtgcctggcaccattggttttgccaccgtgcgtgcaggtgacatcgttggtgaacat
accgcgatgtttgccgatattggcgagcgtctggagatcacccataaggcgtccagccgt
atgacatttgctaacggcgcggtaagatcggctttgtggttgagtggtaaggaaagcggt
ctttttgatatgcgagatgtacttgatctcaataatttgtaa

DBGET integrated database retrieval system