KEGG   Escherichia coli K-12 MG1655: b0031Help
Entry
b0031             CDS       T00007                                 

Gene name
dapB
Definition
(RefSeq) dihydrodipicolinate reductase (EC:1.17.1.8)
  KO
K00215  
4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    b0031 (dapB)
  Amino acid metabolism
   00300 Lysine biosynthesis
    b0031 (dapB)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    b0031 (dapB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     b0031 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
28374..29195
Genome map
AA seq 273 aa AA seqDB search
MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV
TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD
IAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAH
ALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSR
MTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatgcaaacatccgcgttgccatcgcgggagccggggggcgtatgggccgccag
ttgattcaggcggcgctggcattagagggcgtgcagttgggcgctgcgctggagcgtgaa
ggatcttctttactgggcagcgacgccggtgagctggccggagccgggaaaacaggcgtt
accgtgcaaagcagcctcgatgcggtaaaagatgattttgatgtgtttatcgattttacc
cgtccggaaggtacgctgaaccatctcgctttttgtcgccagcatggcaaagggatggtg
atcggcactacggggtttgacgaagccggtaaacaagcaattcgtgacgccgctgccgat
attgcgattgtctttgctgccaattttagcgttggcgttaacgtcatgcttaagctgctg
gagaaagcagccaaagtgatgggtgactacaccgatatcgaaattattgaagcacatcat
agacataaagttgatgcgccgtcaggcaccgcactggcaatgggagaggcgatcgcccac
gcccttgataaagatctgaaagattgcgcggtctacagtcgtgaaggccacaccggtgaa
cgtgtgcctggcaccattggttttgccaccgtgcgtgcaggtgacatcgttggtgaacat
accgcgatgtttgccgatattggcgagcgtctggagatcacccataaggcgtccagccgt
atgacatttgctaacggcgcggtaagatcggctttgtggttgagtggtaaggaaagcggt
ctttttgatatgcgagatgtacttgatctcaataatttgtaa

DBGET integrated database retrieval system