KEGG   Escherichia coli K-12 MG1655: b0035Help
Entry
b0035             CDS       T00007                                 

Gene name
caiE
Definition
(RefSeq) stimulator of CaiD and CaiB enzyme activities
  KO
K08279  
carnitine operon protein CaiE
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(34781..35371)
Genome map
AA seq 196 aa AA seqDB search
MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRGDYGRLIVQAGANIQD
GCIMHGYCDTDTIVGENGHIGHGAILHGCLIGRDALVGMNSVIMDGAVIGEESIVAAMSF
VKAGFRGEKRQLLMGTPARAVRNVSDDELHWKRLNTKEYQDLVGRCHVSLHETQPLRQME
ENRPRLQGTTDVTPKR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgagctattacgcctttgaggggttaattccggtggttcacccgacggcgtttgtccat
cccagtgccgtcttgattggcgatgtgattgtgggagccggtgtctacatcggcccactc
gcctcactgcgtggtgactacgggcggttgatcgtgcaagcgggagccaatattcaggat
ggctgcattatgcatggctactgcgacactgacactatcgttggggaaaacggccatatc
gggcacggagcgatcctgcatggttgtttgattggtcgcgatgcattggtcgggatgaac
agcgtgattatggatggcgcggtcattggcgaagagagcattgttgccgccatgagcttt
gtcaaagcgggctttcgcggcgagaaacgccagttgttgatgggtacgccagcccgcgct
gtacgcaatgttagtgacgacgagttacactggaaacggttgaataccaaagagtatcag
gatcttgtcgggcgctgtcatgtatcgttacatgaaacgcagccactgaggcaaatggag
gaaaatcgcccccgtttgcaggggacgacggatgtgacgcctaaacggtga

DBGET integrated database retrieval system