KEGG   Escherichia coli K-12 MG1655: b0035Help
Entry
b0035             CDS       T00007                                 

Gene name
caiE
Definition
(RefSeq) stimulator of CaiD and CaiB enzyme activities
  KO
K08279  carnitine operon protein CaiE
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-GeneID: 948999
NCBI-ProteinID: NP_414577
Pasteur: caiE
RegulonDB: ECK120002330
ECOCYC: EG12608
ASAP: ABE-0000128
UniProt: P39206
Position
complement(34781..35371)
Genome map
AA seq 196 aa AA seqDB search
MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRGDYGRLIVQAGANIQD
GCIMHGYCDTDTIVGENGHIGHGAILHGCLIGRDALVGMNSVIMDGAVIGEESIVAAMSF
VKAGFRGEKRQLLMGTPARAVRNVSDDELHWKRLNTKEYQDLVGRCHVSLHETQPLRQME
ENRPRLQGTTDVTPKR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgagctattacgcctttgaggggttaattccggtggttcacccgacggcgtttgtccat
cccagtgccgtcttgattggcgatgtgattgtgggagccggtgtctacatcggcccactc
gcctcactgcgtggtgactacgggcggttgatcgtgcaagcgggagccaatattcaggat
ggctgcattatgcatggctactgcgacactgacactatcgttggggaaaacggccatatc
gggcacggagcgatcctgcatggttgtttgattggtcgcgatgcattggtcgggatgaac
agcgtgattatggatggcgcggtcattggcgaagagagcattgttgccgccatgagcttt
gtcaaagcgggctttcgcggcgagaaacgccagttgttgatgggtacgccagcccgcgct
gtacgcaatgttagtgacgacgagttacactggaaacggttgaataccaaagagtatcag
gatcttgtcgggcgctgtcatgtatcgttacatgaaacgcagccactgaggcaaatggag
gaaaatcgcccccgtttgcaggggacgacggatgtgacgcctaaacggtga

DBGET integrated database retrieval system