KEGG   Escherichia coli K-12 MG1655: b0036Help
Entry
b0036             CDS       T00007                                 

Gene name
caiD
Definition
(RefSeq) carnitinyl-CoA dehydratase
  KO
K08299  crotonobetainyl-CoA hydratase [EC:4.2.1.149]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.149  crotonobetainyl-CoA hydratase
     b0036 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 948995
NCBI-ProteinID: NP_414578
RegulonDB: ECK120001510
ECOCYC: EG11557
ASAP: ABE-0000130
UniProt: P31551
Position
complement(35377..36162)
Genome map
AA seq 261 aa AA seqDB search
MSESLHLTRNGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFF
SAGWDLKAAAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIV
CADNASFALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVV
SQAELMDNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEEAYRYIRSGVLKHYPSVLHS
EDAIEGPLAFAEKRDPVWKGR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatcattacatctgacccgcaatggatcaattctggaaattacccttgatcgt
ccaaaagcgaatgctattgatgcaaaaaccagctttgaaatgggcgaagtatttctaaat
ttccgtgacgatccgcaattacgtgtcgccattattaccggtgccggagagaagttcttt
tccgcgggctgggatttaaaagcggcagcagaaggcgaagcaccggatgctgactttggt
ccgggtggttttgcgggattaaccgaaattttcaatctcgacaaaccggttatcgcagct
gtgaacggctatgcctttggcggcggctttgaactggcgctggcggcagattttattgtt
tgtgccgataacgccagcttcgccctgccggaagccaaactgggcatcgttcctgacagc
ggcggtgtgctgcgtctgccgaagatcctgccgcctgccatcgtcaatgaaatggtgatg
accggcagacgaatgggcgcagaagaggcgctgcgttgggggatagtcaaccgcgtggtt
agccaggcggaactgatggataacgcccgcgaactggctcagcagctggttaacagcgcc
ccgctggcgattgcggcgctgaaagagatctaccgcaccaccagcgaaatgccggtagaa
gaagcgtatcgctatattcgcagcggcgtgttgaaacactatccatcggttctgcattcg
gaagatgccattgaagggccgctggcgtttgccgagaagcgcgatccggtgtggaaagga
cgttaa

DBGET integrated database retrieval system