KEGG   Escherichia coli K-12 MG1655: b0037Help
Entry
b0037             CDS       T00007                                 

Gene name
caiC
Definition
(RefSeq) putative crotonobetaine/carnitine-CoA ligase (EC:6.3.2.-)
  KO
K02182  
crotonobetaine/carnitine-CoA ligase [EC:6.2.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     b0037 (caiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(36271..37824)
Genome map
AA seq 517 aa AA seqDB search
MDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSYLELNQEINRTANLFYTLGIR
KGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLCEESAWILQNSQACLLVTSAQFY
PMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPATLCYAPPLSTDDTAEILF
TSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYLTVMPAFHIDCQCTAAMAAFSAG
ATFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMVQPPSANDQQHRLREVMFYLNLS
EQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCYEAEIRDDHNRP
LPAGEIGEICIKGIPGKTIFKEYFLNPQATAKVLEADGWLHTGDTGYRDEEDFFYFVDRR
CNMIKRGGENVSCVELENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEF
FRFCEQNMAKFKVPSYLEIRKDLPRNCSGKIIRKNLK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggatatcattggcggacaacatctacgtcaaatgtgggacgatcttgcggacgtttac
ggtcataaaacggcgctgatttgtgaatccagcggcggagtcgttaaccggtatagttat
cttgagttaaatcaggagattaaccgcacggcaaacctgttttatacgctggggattcgc
aaaggcgacaaggttgcactacatctcgacaactgcccggaatttatcttttgctggttc
gggctggcaaaaattggcgcgattatggtgccgattaacgcccgcctgttgtgcgaggaa
agcgcgtggatcctgcaaaatagccaggcgtgcctgctggtgaccagtgcgcaattctat
cctatgtatcaacagattcagcaggaagatgccactcaattgcggcacatttgcctgaca
gatgtggcacttcccgctgatgatggcgtgagttcgtttactcaactgaaaaatcaacaa
cctgccaccttgtgctatgcaccgccgctatcgactgacgatacggcggaaattctcttc
acctccggcaccacctcccgaccgaaaggtgtggtgattacccattacaacctgcgcttc
gctggatattactccgcctggcagtgtgcactgcgtgacgatgacgtctacctgacggta
atgcctgcgtttcatatcgattgccagtgtactgcggcgatggcggcgttttctgccggg
gccacctttgtgctggtcgagaaatacagcgcccgcgccttctggggacaggtacagaag
taccgcgccaccgttaccgaatgtattccgatgatgatccgtacgttgatggtacagccg
ccttcagcgaacgatcagcaacaccgcctgcgggaagtgatgttttatctcaacttgtcg
gagcaggaaaaagatgcgttttgtgaacgcttcggcgttcgcttgctgacgtcttatggg
atgacggaaaccattgtgggcattatcggcgatcgtcctggcgataaacgacgctggccg
tcgattggtcgggtggggttttgctacgaagcggagatccgcgacgatcacaatcgcccg
ctcccggctggtgagatcggtgaaatctgcattaaaggcatacctgggaaaaccatcttc
aaagagtactttctcaacccacaagccactgcgaaagtgctggaagccgatggctggctg
cataccggcgataccggataccgcgacgaagaggactttttttatttcgtcgatcgccgc
tgcaatatgattaaacgtggcggcgagaatgtctcctgcgtggagctggaaaatattatc
gccgcgcacccgaaaattcaggacatcgtggttgtgggtattaaagattcgattcgcgat
gaagccatcaaagcatttgtggtgctgaatgaaggtgaaacattgagcgaagaggaattt
ttccgcttctgcgaacaaaatatggcgaaatttaaagtgccctcttatctggagatcaga
aaagatctgccacgtaattgctcggggaaaataattagaaagaatctgaaataa

DBGET integrated database retrieval system