KEGG   Escherichia coli K-12 MG1655: b0037Help
Entry
b0037             CDS       T00007                                 

Gene name
caiC
Definition
(RefSeq) putative crotonobetaine/carnitine-CoA ligase
  KO
K02182  carnitine-CoA ligase [EC:6.2.1.48]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.48  carnitine---CoA ligase
     b0037 (caiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Response_reg
Motif
Other DBs
NCBI-GeneID: 944886
NCBI-ProteinID: NP_414579
RegulonDB: ECK120001511
ECOCYC: EG11558
ASAP: ABE-0000133
UniProt: P31552
Position
complement(36271..37824)
Genome map
AA seq 517 aa AA seqDB search
MDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSYLELNQEINRTANLFYTLGIR
KGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLCEESAWILQNSQACLLVTSAQFY
PMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPATLCYAPPLSTDDTAEILF
TSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYLTVMPAFHIDCQCTAAMAAFSAG
ATFVLVEKYSARAFWGQVQKYRATVTECIPMMIRTLMVQPPSANDQQHRLREVMFYLNLS
EQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCYEAEIRDDHNRP
LPAGEIGEICIKGIPGKTIFKEYFLNPQATAKVLEADGWLHTGDTGYRDEEDFFYFVDRR
CNMIKRGGENVSCVELENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEF
FRFCEQNMAKFKVPSYLEIRKDLPRNCSGKIIRKNLK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggatatcattggcggacaacatctacgtcaaatgtgggacgatcttgcggacgtttac
ggtcataaaacggcgctgatttgtgaatccagcggcggagtcgttaaccggtatagttat
cttgagttaaatcaggagattaaccgcacggcaaacctgttttatacgctggggattcgc
aaaggcgacaaggttgcactacatctcgacaactgcccggaatttatcttttgctggttc
gggctggcaaaaattggcgcgattatggtgccgattaacgcccgcctgttgtgcgaggaa
agcgcgtggatcctgcaaaatagccaggcgtgcctgctggtgaccagtgcgcaattctat
cctatgtatcaacagattcagcaggaagatgccactcaattgcggcacatttgcctgaca
gatgtggcacttcccgctgatgatggcgtgagttcgtttactcaactgaaaaatcaacaa
cctgccaccttgtgctatgcaccgccgctatcgactgacgatacggcggaaattctcttc
acctccggcaccacctcccgaccgaaaggtgtggtgattacccattacaacctgcgcttc
gctggatattactccgcctggcagtgtgcactgcgtgacgatgacgtctacctgacggta
atgcctgcgtttcatatcgattgccagtgtactgcggcgatggcggcgttttctgccggg
gccacctttgtgctggtcgagaaatacagcgcccgcgccttctggggacaggtacagaag
taccgcgccaccgttaccgaatgtattccgatgatgatccgtacgttgatggtacagccg
ccttcagcgaacgatcagcaacaccgcctgcgggaagtgatgttttatctcaacttgtcg
gagcaggaaaaagatgcgttttgtgaacgcttcggcgttcgcttgctgacgtcttatggg
atgacggaaaccattgtgggcattatcggcgatcgtcctggcgataaacgacgctggccg
tcgattggtcgggtggggttttgctacgaagcggagatccgcgacgatcacaatcgcccg
ctcccggctggtgagatcggtgaaatctgcattaaaggcatacctgggaaaaccatcttc
aaagagtactttctcaacccacaagccactgcgaaagtgctggaagccgatggctggctg
cataccggcgataccggataccgcgacgaagaggactttttttatttcgtcgatcgccgc
tgcaatatgattaaacgtggcggcgagaatgtctcctgcgtggagctggaaaatattatc
gccgcgcacccgaaaattcaggacatcgtggttgtgggtattaaagattcgattcgcgat
gaagccatcaaagcatttgtggtgctgaatgaaggtgaaacattgagcgaagaggaattt
ttccgcttctgcgaacaaaatatggcgaaatttaaagtgccctcttatctggagatcaga
aaagatctgccacgtaattgctcggggaaaataattagaaagaatctgaaataa

DBGET integrated database retrieval system