KEGG   Escherichia coli K-12 MG1655: b0040Help
Entry
b0040             CDS       T00007                                 

Gene name
caiT
Definition
(RefSeq) putative transporter
  KO
K05245  
L-carnitine/gamma-butyrobetaine antiporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0040 (caiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(40417..41931)
Genome map
AA seq 504 aa AA seqDB search
MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMV
VMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPP
FGLEPNSTGAKELGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVG
EKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIPHTLQLDAIIITCWI
ILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRM
LFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVLGLTASTW
ILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWAALPLSTATMWGFFILCFIATV
TLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGIIGIVLLALGGLKPIQTAIIAGG
CPLFFVNIMVTLSFIKDAKQNWKD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgaaaagagaaaaacgggaatagaaccgaaggttttctttccgccgttaata
atcgtcggcatactttgttggcttacagtcagagatctggatgcagcgaatgtcgttatt
aatgctgtattcagttacgtcaccaatgtatggggatgggcatttgaatggtatatggtg
gtgatgcttttcggttggttctggctggtgtttggcccgtatgccaaaaagcgtttaggt
aacgaaccgccagaatttagcaccgccagttggatctttatgatgttcgcctcctgtacg
tctgctgccgtactgttctggggatcgattgagatctactactacatctccaccccgccg
tttggcttagaaccgaactcgacaggggcgaaagagttggggctggcttacagcttgttc
cactggggacctctgccgtgggccacttacagcttcctttcagtcgccttcgcttacttc
ttctttgtccgcaaaatggaagtgattcgccccagctcgacactggtgccgctggtaggt
gaaaaacacgccaaagggttgttcggcactatcgtcgacaacttctatctcgtcgccttg
atcttcgcgatgggtaccagtctgggccttgccacgccgctggtgaccgagtgtatgcaa
tggttgtttggcattccgcataccctgcaactggacgctatcatcattacctgctggatt
atcctcaacgccatttgcgtcgcttgcggtctgcaaaaaggggtacgtatcgccagtgac
gtgcgtagttacctgagcttcctgatgctgggttgggtgttcattgtcagcggtgccagc
ttcatcatgaactacttcaccgattcggtggggatgttgctgatgtatctgccgcgcatg
ttgttctataccgatcccatcgctaaaggcggcttcccgcagggctggaccgtgttctac
tgggcatggtgggtgatttatgctatccagatgagtatcttcctcgcccgcatctcccgt
ggtcgtactgtgcgtgaactgtgcttcggcatggtgctggggctgacagcgtcaacctgg
atcctgtggactgtactcggtagtaacactctgctgttgatagataaaaacatcatcaac
attccaaatctgatcgaacagtacggtgtggcgcgcgccatcattgaaacctgggccgct
ctgccactcagcaccgccaccatgtggggcttcttcatcctctgctttattgccaccgtt
acgctggttaacgcctgctcttataccctggcgatgtccacttgccgcgaagtacgcgat
ggtgaagaaccacctctgctggtgcgtatcggttggtcaattctggttggcattatcggt
attgttctgctggcgctcggcggcctgaaaccgattcaaaccgccattatcgccggagga
tgcccgctgttcttcgtcaacattatggtgacgctctcctttattaaagacgcgaaacag
aactggaaagattaa

DBGET integrated database retrieval system