KEGG   Escherichia coli K-12 MG1655: b0043Help
Entry
b0043             CDS       T00007                                 

Gene name
fixC
Definition
(RefSeq) putative oxidoreductase
  KO
K00313  
electron transfer flavoprotein-quinone oxidoreductase [EC:1.5.5.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.-  
     b0043 (fixC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
44180..45466
Genome map
AA seq 428 aa AA seqDB search
MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNVTGGRLYAHSLEHIIP
GFADSAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYSVLRSKFDAWLMEQAEE
AGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVNSILAEKLGMAKRVKPTD
VAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMGGGFLYTNENTLSLGLVCG
LHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVVPEAGINMLPELVGDGVLIA
GDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDFSKQKLAEYRQHLESGPLRDM
RMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPELMRKKILRHGKKVGFINLIKD
GMKGVTVL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagatatctttgacgccatcatcgtcggtgcagggcttgccggttcggttgcc
gcactggtgctcgcccgcgaaggtgcgcaagtgttagttatcgagcgtggcaattccgca
ggtgccaagaacgtcaccggcgggcgtctctatgcccacagtctggaacacattattcct
ggtttcgccgactccgcccccgtagaacgcctgatcacccatgaaaaactcgcgtttatg
acggaaaagtcagcgatgactatggactactgcaatggtgacgaaacctcgccatcccag
cgttcttactccgttttgcgcagtaaatttgatgcctggctgatggagcaggccgaagaa
gcgggcgcgcagttaattaccgggatccgcgtcgataacctcgtacagcgcgatggcaaa
gtcgtcggtgtagaagccgatggcgatgtgattgaagcgaaaacggtgatccttgctgat
ggggtgaactccatccttgccgaaaaattggggatggcaaaacgcgtcaaaccgacggat
gtggcggttggcgtgaaggaactgatcgagttaccgaagtcggttattgaagaccgtttt
cagttgcagggtaatcagggggcggcttgcctgtttgcgggatcacccaccgatggcctg
atgggcggcggcttcctttataccaatgaaaacaccctgtcgctggggctggtttgtggt
ttgcatcatctgcatgacgcgaaaaaatcggtgccgcaaatgctggaagatttcaaacag
catccggccgttgcaccgctgatcgcgggcggcaagctggtggaatattccgctcacgta
gtgccggaagcaggcatcaacatgctgccggagttggttggtgacggcgtattgattgcc
ggtgatgccgccggaatgtgtatgaacctcggttttaccattcgcggtatggatctggcg
attgccgccggggaagccgcagcaaaaaccgtgctttcagcgatgaaaagcgacgatttc
agtaagcaaaaactggcggaatatcgtcagcatcttgagagtggtccgctgcgcgatatg
cgtatgtaccagaaactaccggcgttccttgataacccacgcatgtttagcggctacccg
gagctggcggtgggtgtggcgcgtgacctgttcaccattgatggcagcgcgccggaactg
atgcgcaagaaaatcctccgccacggcaagaaagtgggcttcatcaatctaatcaaggat
ggcatgaaaggagtgaccgttttatga

DBGET integrated database retrieval system