KEGG   Escherichia coli K-12 MG1655: b0045Help
Entry
b0045             CDS       T00007                                 

Gene name
yaaU
Definition
(RefSeq) putative transporter
  KO
K08368  
MFS transporter, putative metabolite transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    b0045 (yaaU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
45807..47138
Genome map
AA seq 443 aa AA seqDB search
MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVALEQLTPALKLDADWIGLLGA
GTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVSSPVELLVMRVLIGIVI
GADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGYWLYDVEGGWRWMLGSAA
IPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVAFDEEQPQQTRFRDLFNRR
HFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNAALGNVVISLFFMLGCIPPM
LWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMAFAVYAFFSGGPGNLQWLYPN
ELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGISNTMLMGAGISLFGLLISVAF
APETRGMSLAQTSNMTIRGQRMG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgtccagaaactttgacgatctcaaattctcctctattcaccgccgcattttg
ctgtggggaagcggtggtccgtttctggatggttatgtactggtaatgattggcgtggcg
ctggagcaactgacgccggcgctgaaactggacgctgactggattggcttgctgggcgcg
ggaacgctcgccgggctgttcgttggcacatcgctgtttggttatatttccgataaagtc
ggacggcgcaaaatgttcctcattgatatcatcgccatcggcgtgatatcggtggcgacg
atgtttgtttcatcccccgtcgaactgttggtgatgcgggtacttatcggcattgtcatc
ggtgcagattatcccatcgccacctcaatgatcaccgagttctccagtacccgtcagcgg
gcgttttccatcagctttattgccgcgatgtggtatgtcggcgcgacctgtgccgatctg
gtcggctactggctttatgatgtggaaggcggctggcgctggatgctgggtagcgcggcg
atcccctgtttgttgattttgattggtcgattcgaactgcctgaatctccccgctggtta
ttacgcaaagggcgagtaaaagagtgcgaagagatgatgatcaaactgtttggcgaaccg
gtggctttcgatgaagagcagccgcagcaaacccgttttcgcgatctgtttaatcgccgc
cattttccttttgttctgtttgttgccgccatctggacctgccaggtgatcccaatgttc
gccatttacacctttggcccgcaaatcgttggtttgttgggattgggggttggcaaaaac
gcggcactagggaatgtggtgattagcctgttctttatgctcggctgtattccgccgatg
ctgtggttaaacactgccggacggcgtccattgttgattggcagctttgccatgatgacg
ctggcgctggcggttttggggctaatcccggatatggggatctggctggtagtgatggcc
tttgcggtgtatgcctttttctctggcgggccgggtaatttgcagtggctctatcctaat
gaactcttcccgacagatatccgcgcctctgccgtgggcgtgattatgtccttaagtcgt
attggcaccattgtttcgacctgggcactaccgatctttatcaataattacggtatcagt
aacacgatgctaatgggggcgggtatctcgctgtttggcttgttgatttccgtagcgttt
gccccggagactcgagggatgtcactggcgcagaccagcaatatgacgatccgcgggcag
agaatggggtaa

DBGET integrated database retrieval system