KEGG   Escherichia coli K-12 MG1655: b0047Help
Entry
b0047             CDS       T00007                                 

Gene name
kefC
Definition
(RefSeq) potassium:proton antiporter
  KO
K11745  
glutathione-regulated potassium-efflux system ancillary protein KefC
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0047 (kefC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
47769..49631
Genome map
AA seq 620 aa AA seqDB search
MDSHTLIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAESILHFAE
IGVVLMLFIIGLELDPQRLWKLRAAVFGCGALQMVICGGLLGLFCMLLGLRWQVAELIGM
TLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLVAMIPLLATSSASTTMGA
FALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAVALFLVFGFGLLLEEVGLS
MAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLLENPLRIVILL
LGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAFVVFGAAQMANVLEPEWAKSL
TLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQPRVIIAGFGRFGQITGRLLLS
SGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTNLQL
TEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKTGRLALESLGLGPYEA
RERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTSAMLSEIITEDREHLSLIQRHGWQG
TEEGKHTGNMADEPETKPSS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggatagccatacgctgattcaggcgctgatttatctcggttcggcagcgctgattgta
cccattgcggtacgtcttggtctgggatcggtacttggctacctgatcgccggctgcatt
attggcccgtgggggctgcgactggtgaccgatgccgaatctattctgcactttgccgag
attggggtggtgctgatgctgtttattatcggcctcgaactcgatccacaaaggctgtgg
aagctgcgtgcggcagtgttcggctgtggcgcattgcagatggtgatttgcggcggcctg
ctggggctgttctgcatgttacttgggctgcgctggcaggtcgcggaattgatcggcatg
acgctggcgctctcctctacggcgattgccatgcaggcgatgaatgaacgcaatctgatg
gtgacgcaaatgggtcgcagtgcctttgcggtgctgctgttccaggatatcgcggcgatc
ccgctggtggcgatgattccgctactggcaacgagcagtgcctcgacgacgatgggcgca
tttgctctctcggcgttaaaagtggcgggtgcgctggtgctggtggtattgctggggcgc
tatgtcacgcgtccggcgctgcgttttgtagcccgctctggcttgcgggaagtgtttagt
gccgtggcgttattcctcgtgtttggctttggtttgctgctggaagaggtcggcttgtcg
atggcgatgggcgcgtttctggcgggcgtactgctggcaagctcggaataccgtcatgcg
ctggagagcgatatcgaaccatttaaaggtttgctgttggggctgtttttcatcggtgtt
ggcatgtcgatagactttggcacgctgcttgaaaacccattgcgcattgtcattttgctg
ctcggtttcctcatcatcaaaatcgccatgctgtggctgattgcccgaccgttgcaagtg
ccaaataaacagcgtcgttggtttgcggtgttgttagggcagggcagtgagtttgccttt
gtggtatttggcgcggcgcagatggcgaatgtgctggagccggagtgggcgaaatcgctg
accctggcggtggcgctgtcgatggcagcaacgccgattctgctggtgatcctcaatcgc
cttgagcaatcttctactgaggaagcgcgtgaagccgatgagatcgacgaagaacagccg
cgcgtgattatcgccggattcggtcgttttgggcagattaccggacgtttactgctctcc
agcggggtgaaaatggtggtactcgatcacgatccggaccatatcgaaaccttgcgtaaa
tttggtatgaaagtgttttatggcgatgccacgcggatggatttactggaatctgccgga
gcggcgaaagcggaagtgctgattaacgccatcgacgatccgcaaaccaacctgcaactg
acagagatggtgaaagaacatttcccgcatttgcagattattgcccgcgcccgcgatgtc
gaccactacattcgtttgcgtcaggcaggcgttgaaaagccggagcgtgaaaccttcgaa
ggtgcgctgaaaaccgggcgtctggcactggaaagtttaggtctggggccgtatgaagcg
cgagaacgtgccgatgtgttccgccgctttaatattcagatggtggaagagatggcaatg
gttgagaacgacaccaaagcccgcgcggcggtctataaacgcaccagcgcgatgttaagt
gagatcattaccgaggaccgcgaacatctgtcattaattcaacgacatggctggcaggga
accgaagaaggtaaacataccggcaacatggcggatgaaccggaaacgaaaccctcatcc
taa

DBGET integrated database retrieval system