KEGG   Escherichia coli K-12 MG1655: b0051Help
Entry
b0051             CDS       T00007                                 

Gene name
rsmA
Definition
(RefSeq) 16S rRNA m(6)A1518, m(6)A1519 dimethyltransferase, SAM-dependent (EC:2.1.1.-)
  KO
K02528  
16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.182  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase
     b0051 (rsmA)
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    b0051 (rsmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(51609..52430)
Genome map
AA seq 273 aa AA seqDB search
MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLD
QLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKMGQPLRVFGNLPYNIST
PLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCNVIPVLEVPPSA
FTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTG
MGIDPAMRAENISVAQYCQMANYLAENAPLQES
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgagtccaccagggccacttagcccgtaaacgcttcgggcaaaactttctc
aacgatcagttcgtgatcgacagtattgtgtctgccattaacccgcaaaagggccaggcg
atggtcgaaatcggccccggtctggcggcattgaccgaaccggtcggcgaacgtctggac
cagctgacggtcatcgaacttgaccgcgatctggcggcacgtctgcaaacgcatccattc
ttaggcccgaaactgacgatttatcagcaggatgcgatgacctttaactttggtgaactg
gccgagaaaatgggtcagccgctgcgtgttttcggcaacctgccttataacatctccacg
ccgttgatgttccatctgtttagctatactgatgccattgccgacatgcactttatgttg
caaaaagaggtggtgaatcgtctggttgcaggaccgaacagcaaagcgtatggtcgatta
agcgtcatggcgcaatactattgcaatgtgatcccggtactggaagtaccgccgtcagcc
tttacaccaccacccaaagtggattccgccgtcgtgcgcctggttcctcatgcaacgatg
cctcacccggttaaagatgttcgtgtgttgagccgcatcaccaccgaagcctttaaccag
cgtcgtaaaaccattcgtaacagcctcggcaacctgtttagcgtcgaggtgttaacggga
atggggatcgacccggcgatgcgagcggaaaatatctctgtcgcgcaatattgccagatg
gcgaactatctggcggagaacgcgcctttgcaggagagttaa

DBGET integrated database retrieval system