KEGG   Escherichia coli K-12 MG1655: b0054Help
Entry
b0054             CDS       T00007                                 

Gene name
lptD
Definition
(RefSeq) LPS assembly OM complex LptDE, beta-barrel component
  KO
K04744  
LPS-assembly protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0054 (lptD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(54755..57109)
Genome map
AA seq 784 aa AA seqDB search
MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAK
GDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILK
GPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTW
SVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNY
FEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYED
EHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFS
VGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNT
RDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHYQQTNLDWYNSRNTTKLDESVNR
VMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGL
FRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWEND
DKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYRYAS
PEYIQATLPKYYSTAEQYKNGISQVGAVASWPIADRWSIVGAYYYDTNANKQADSMLGVQ
YSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPY
QNTL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtatccccactctcctggccaccatgattgccaccgccctttatagtcaa
cagggactggcagccgacctcgcctcacagtgcatgttgggcgtgccaagctatgaccgt
cctctggtacagggcgataccaatgacttacccgtgactatcaatgctgaccacgcgaaa
ggggactacccggatgacgccgtgtttactggcagcgtggatatcatgcagggtaacagc
cgtctgcaggccgacgaagtgcagctccatcaaaaagaggcaccaggacaaccggagccg
gtacgtaccgttgatgcgctcggtaatgtccattacgacgataaccaggtgatcctcaaa
gggccgaaaggctgggcgaatctgaacaccaaagataccaacgtctgggaaggtgattac
cagatggtgggtcgccagggtcgcggtaaagcggacctgatgaaacaacgtggcgaaaac
cgctataccattctggataacggtagctttacctcctgtctgccgggttctgacacctgg
agcgtggtaggtagcgaaattattcatgaccgcgaagaacaagttgcggagatctggaac
gcccgctttaaggtgggtccggtaccgatcttttatagcccctatttgcagttgccggtg
ggtgacaaacgtcgctctggtttcttgatcccgaacgccaagtacaccaccaccaactac
tttgagttctacctgccatattactggaacatcgcgccaaatatggatgccaccatcacg
ccgcattatatgcatcgtcgtggcaacatcatgtgggagaacgaattccgctacctctcc
caggcgggcgctggcttgatggaactggactatctgccttcagataaagtctatgaagat
gaacacccgaacgatgacagttcacgtcgttggttattctactggaaccactccggggtc
atggatcaggtgtggcgtttcaacgtcgactacaccaaggtcagcgatcctagctacttc
aatgatttcgataacaagtacggttccagtactgacggctacgcaacgcaaaaattcagc
gttggctatgcggtgcaaaacttcaatgccaccgtttcaaccaagcagttccaggttttc
agcgaacagaacaccagtagctactcggcagagccgcagttagacgttaattactaccag
aatgatgttggtccgtttgatacgcgtatttacggccaggcagtgcactttgttaacacc
agagacgacatgcctgaagcaacccgtgttcacctggaaccgaccatcaatttgccgctc
tctaataactggggcagcatcaataccgaagcgaagttgctggcaacccattatcagcaa
accaatcttgactggtataactccagaaacacgaccaagctggacgaatccgttaaccgc
gtaatgccgcaattcaaagttgacggcaaaatggtctttgaacgcgatatggaaatgctg
gctccgggttatacccaaacgctggaaccgcgcgcgcagtatttgtacgtgccgtatcgc
gatcagagcgacatctataactacgactcgtctctgctgcaatctgactactctggcctg
ttccgggaccggacttacggcggtcttgaccgtattgcctccgctaaccaggtgacgacc
ggtgtcacatctcgcatatatgatgatgctgccgttgaacgttttaatatttccgttggt
caaatctactatttcacggagtctcgcactggcgatgacaacataacatgggagaatgac
gacaaaacgggttcactggtgtgggcaggcgatacttactggcgtatctccgagcgttgg
ggattgcgtggcgggattcagtacgatacacgtctggataacgtagcgaccagtaactcc
agcattgaataccgtcgggatgaagaccgtctggtacagctgaattaccgttacgccagc
ccggaatatattcaggctacgctgcctaagtactattccactgctgagcaatataagaat
ggtatttcgcaggtaggtgctgtcgccagctggccaattgccgatcgttggtccattgtt
ggggcctactactacgacaccaatgctaacaagcaagccgactctatgttaggtgtgcaa
tacagctcctgctgctatgcaattcgcgtcggttacgagcggaagctgaacggttgggat
aacgataaacaacatgcggtatatgacaacgcaatcggctttaacatcgaacttcgcggc
ctgagctccaactacggtctgggtacgcaagagatgctgcgttcgaacattctgccgtat
caaaacactttgtga

DBGET integrated database retrieval system