KEGG   Escherichia coli K-12 MG1655: b0061Help
Entry
b0061             CDS       T00007                                 

Gene name
araD
Definition
(RefSeq) L-ribulose-5-phosphate 4-epimerase
  KO
K01786  
L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    b0061 (araD)
Enzymes [BR:eco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     b0061 (araD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(65855..66550)
Genome map
AA seq 231 aa AA seqDB search
MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSGVDYSVMTADDMVVVS
IETGEVVEGTKKPSSDTPTHRLLYQAFPSIGGIVHTHSRHATIWAQAGQSIPATGTTHAD
YFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAQMPGVLVHSHGPFAWGKNA
EDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRKHGAKAYYGQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagatctcaaacgccaggtattagaagccaacctggcgctgccaaaacacaac
ctggtcacgctcacatggggcaacgtcagcgccgttgatcgcgagcgcggcgtctttgtg
atcaaaccttccggcgtcgattacagcgtcatgaccgctgacgatatggtcgtggttagc
atcgaaaccggtgaagtggttgaaggtacgaaaaagccctcctccgacacgccaactcac
cggctgctctatcaggcattcccctccattggcggcattgtgcatacgcactcgcgccac
gccaccatctgggcgcaggcgggtcagtcgattccagcaaccggcaccacccacgccgac
tatttctacggcaccattccctgcacccgcaaaatgaccgacgcagaaatcaacggcgaa
tatgagtgggaaaccggtaacgtcatcgtagaaacctttgaaaaacagggtatcgatgca
gcgcaaatgcccggcgttctggtccattcccacggcccgtttgcatggggcaaaaatgcc
gaagatgcggtgcataacgccatcgtgctggaagaggtcgcttatatggggatattctgc
cgtcagttagcgccgcagttaccggatatgcagcaaacgctgctggataaacactatctg
cgtaagcatggcgcgaaggcatattacgggcagtaa

DBGET integrated database retrieval system