KEGG   Escherichia coli K-12 MG1655: b0063Help
Entry
b0063             CDS       T00007                                 

Gene name
araB
Definition
(RefSeq) L-ribulokinase (EC:2.7.1.16)
  KO
K00853  
L-ribulokinase [EC:2.7.1.16]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    b0063 (araB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.16  ribulokinase
     b0063 (araB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(68348..70048)
Genome map
AA seq 566 aa AA seqDB search
MAIAIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCDAPNNQFRHHPRDYIES
MEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLALRPEFAENPNAMFVLWK
DHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHVTRQDSAVAQSAASWIEL
CDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASFFDELDPILNRHLPSPLFT
DTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVGAGAQPNALVKVIGTSTCDI
LIADKQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGDIYAWFGRVLGWPLEQLAAQH
PELKTQINASQKQLLPALTEAWAKNPSLDHLPVVLDWFNGRRTPNANQRLKGVITDLNLA
TDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMALGGIARKNQVIMQACCDVLNRPL
QIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASAVEKTLQPCSEQAQRFEQLYRRYQ
QWAMSAEQHYLPTSAPAQAAQAVATL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgcaattggcctcgattttggcagtgattctgtgcgagctttggcggtggac
tgcgctaccggtgaagagatcgccaccagcgtagagtggtatccccgttggcagaaaggg
caattttgtgatgccccgaataaccagttccgtcatcatccgcgtgactacattgagtca
atggaagcggcactgaaaaccgtgcttgcagagcttagcgtcgaacagcgcgcagctgtg
gtcgggattggcgttgacagtaccggctcgacgcccgcaccgattgatgccgacggaaac
gtgctggcgctgcgcccggagtttgccgaaaacccgaacgcgatgttcgtattgtggaaa
gaccacactgcggttgaagaagcggaagagattacccgtttgtgccacgcgccgggcaac
gttgactactcccgctacattggtggtatttattccagcgaatggttctgggcaaaaatc
ctgcatgtgactcgccaggacagcgccgtggcgcaatctgccgcatcgtggattgagctg
tgcgactgggtgccagctctgctttccggtaccacccgcccgcaggatattcgtcgcgga
cgttgcagcgccgggcataaatctctgtggcacgaaagctggggcggcctgccgccagcc
agtttctttgatgagctggacccgatcctcaatcgccatttgccttccccgctgttcact
gacacttggactgccgatattccggtgggcaccttatgcccggaatgggcgcagcgtctc
ggcctgcctgaaagcgtggtgatttccggcggcgcgtttgactgccatatgggcgcagtt
ggcgcaggcgcacagcctaacgcactggtaaaagttatcggtacttccacctgcgacatt
ctgattgccgacaaacagagcgttggcgagcgggcagttaaaggtatttgcggtcaggtt
gatggcagcgtggtgcctggatttatcggtctggaagcaggccaatcggcgtttggtgat
atctacgcctggtttggtcgcgtactcggctggccgctggaacagcttgccgcccagcat
ccggaactgaaaacgcaaatcaacgccagccagaaacaactgcttccggcgctgaccgaa
gcatgggccaaaaatccgtctctggatcacctgccggtggtgctcgactggtttaacggc
cgccgcacaccgaacgctaaccaacgcctgaaaggggtgattaccgatcttaacctcgct
accgacgctccgctgctgttcggcggtttgattgctgccaccgcctttggcgcacgcgca
atcatggagtgctttaccgatcaggggatcgccgttaataacgtgatggcactgggcggc
atcgcgcggaaaaaccaggtcattatgcaggcctgctgcgacgtgctgaatcgcccgctg
caaattgttgcctctgaccagtgctgtgcgctcggtgcggcgatttttgctgccgtcgcc
gcgaaagtgcacgcagacatcccatcagctcagcaaaaaatggccagtgcggtagagaaa
accctgcaaccgtgcagcgagcaggcacaacgctttgaacagctttatcgccgctatcag
caatgggcgatgagcgccgaacaacactatcttccaacttccgccccggcacaggctgcc
caggccgttgcgactctataa

DBGET integrated database retrieval system