KEGG   Escherichia coli K-12 MG1655: b0064Help
Entry
b0064             CDS       T00007                                 

Gene name
araC
Definition
(RefSeq) ara regulon transcriptional activator; autorepressor
  KO
K02099  
AraC family transcriptional regulator, arabinose operon regulatory protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    b0064 (araC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
70387..71265
Genome map
AA seq 292 aa AA seqDB search
MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGYILNLTIRGQGVVKNQ
GREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYWHEWLNWPSIFANTGFF
RPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRRMEAINESLHPPMDNRVR
EACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLS
TTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCEEKVNDVAVKLS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaaaatgatcccctgctgccgggatactcgtttaacgcccatctggtg
gcgggtttaacgccgattgaggccaacggttatctcgatttttttatcgaccgaccgctg
ggaatgaaaggttatattctcaatctcaccattcgcggtcagggggtggtgaaaaatcag
ggacgagaatttgtctgccgaccgggtgatattttgctgttcccgccaggagagattcat
cactacggtcgtcatccggaggctcgcgaatggtatcaccagtgggtttactttcgtccg
cgcgcctactggcatgaatggcttaactggccgtcaatatttgccaatacgggtttcttt
cgcccggatgaagcgcaccagccgcatttcagcgacctgtttgggcaaatcattaacgcc
gggcaaggggaagggcgctattcggagctgctggcgataaatctgcttgagcaattgtta
ctgcggcgcatggaagcgattaacgagtcgctccatccaccgatggataatcgggtacgc
gaggcttgtcagtacatcagcgatcacctggcagacagcaattttgatatcgccagcgtc
gcacagcatgtttgcttgtcgccgtcgcgtctgtcacatcttttccgccagcagttaggg
attagcgtcttaagctggcgcgaggaccaacgcattagtcaggcgaagctgcttttgagc
actacccggatgcctatcgccaccgtcggtcgcaatgttggttttgacgatcaactctat
ttctcgcgagtatttaaaaaatgcaccggggccagcccgagcgagtttcgtgccggttgt
gaagaaaaagtgaatgatgtagccgtcaagttgtcataa

DBGET integrated database retrieval system