KEGG   Escherichia coli K-12 MG1655: b0067Help
Entry
b0067             CDS       T00007                                 

Gene name
thiP
Definition
(RefSeq) thiamine, thiamine pyrophosphate ABC transporter permease; ThiBPQ thiamine, thiamine pyrophosphate importer
  KO
K02063  
thiamine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Thiamine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0067 (thiP)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Thiamine transporter [MD:M00191] [OT]
    b0067 (thiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(72911..74521)
Genome map
AA seq 536 aa AA seqDB search
MATRRQPLIPGWLIPGVSATTLVVAVALAAFLALWWNAPQDDWVAVWQDSYLWHVVRFSF
WQAFLSALLSVIPAIFLARALYRRRFPGRLALLRLCAMTLILPVLVAVFGILSVYGRQGW
LATLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALENIPGEQRQLAAQLGMRS
WHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQATTIELAIYQALSYDYDP
ARAAMLALLQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDPDDRLHSRICDTVLIVLALL
LLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALAAGVLCVVLTMMLLWSSRELR
ARQKMLAGQVLEMSGMLILAMPGIVLATGFFLLLNNTIGLPQSADGIVIFTNALMAIPYA
LKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRALKRPLAQALAFACVLSIGDFGVV
ALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLLCFLLFTVIEKLPGRNVKTD
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcgccgtcagccgttaattcccggctggttaattccaggtgtaagcgccacc
acgctggtggtagcggttgcgctggcggcgtttctcgccctgtggtggaacgcgccgcag
gatgactgggtggcagtctggcaggacagctatctgtggcatgtggtgcgcttctccttc
tggcaggcgtttctctcggcactgctctctgtcatacccgcgatattcctcgcccgcgcg
ctctatcgcaggcgctttccgggtcggctggcgctgttgcgtctgtgtgcaatgaccttg
atcctcccggtgttggtcgctgttttcggcattcttagcgtctatggtcgccagggctgg
ctggcaacactctgccaatcgctcggtctggagtggaccttttcgccctacggcctgcaa
ggtattttgctggcccatgtgttttttaatctgccgatggcgagccgcttattactccag
gcactggaaaacatccccggcgaacagcgtcaacttgccgcccagcttgggatgcgtagc
tggcattttttccgcttcgtcgaatggccgtggttacggcgacaaatcccgccggttgct
gcgcttatctttatgctctgtttcgccagcttcgccaccgtgctatcgctggggggcggt
ccgcaggcgaccactatcgagctggcaatctatcaggcgctgagttacgactacgatcct
gcccgcgcggcaatgctggcgctgctccagatggtgtgctgcctcgggctggtgctgttg
agtcagcgattgagtaaggccattgcgcccggcaccacgctgctgcaaggctggcgcgac
ccggacgatcgtctgcatagccgcatttgcgacacggtgttaattgtgctggcgctgctg
ctgttgctgccaccgttactggcggtgatcgtcgatggggtaaatcgccagttgccggaa
gtgctggcacaaccggtgctgtggcaggcgctgtggacctcgttgcgtattgcgctggcg
gcaggtgtattgtgcgtagtgctgaccatgatgctgctatggagcagtcgcgaactgcgg
gcgcggcagaaaatgctggcgggtcaggtgctggagatgagcggcatgttgatcctcgcc
atgccggggattgtgctggctaccggcttctttttactgctcaacaacactatcggcctg
ccacaatctgctgacggcattgtgattttcaccaatgcgttaatggcgatcccttatgcg
ctgaaagtgctggaaaacccgatgcgcgatatcaccgcccgctacagcatgttatgtcag
tcgctggggattgaaggctggtcacgcttaaaagtggtggagctgcgcgccctgaaacgt
ccactggcgcaggcgctggcctttgcatgcgtgctgtcgattggtgattttggcgtggtg
gcgttgttcggtaacgatgatttccgcaccctgccgttttatctctaccagcaaattggc
tcctatcgcagccaggacggtgcggtcaccgcgttaattctgctgctgctctgttttctg
ctgtttaccgtgattgaaaaactaccggggcgaaatgttaaaactgactga

DBGET integrated database retrieval system