KEGG   Escherichia coli K-12 MG1655: b0068Help
Entry
b0068             CDS       T00007                                 

Gene name
thiB
Definition
(RefSeq) thiamine-, thiamine pyrophosphate-, thiamine monophosphate-binding ABC transporter periplasmic protein; ThiBPQ thiamine, thiamine pyrophosphate importer
  KO
K02064  
thiamine transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Thiamine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0068 (thiB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Thiamine transporter [MD:M00191] [OT]
    b0068 (thiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(74497..75480)
Genome map
AA seq 327 aa AA seqDB search
MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDG
VSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPF
DYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAP
QAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGH
YLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPA
TTLEFTPAEVAAQRQAWISEWQRAVSR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaaaaatgtctgcccctgctgttgctgtgcacagcgcccgttttcgctaaaccc
gttctgactgtttatacctacgattccttcgccgccgactgggggcctggtccggtggtt
aaaaaagcctttgaagccgactgtaattgcgaactgaaactggtggcgctggaagatggc
gtttcgcttctcaaccgtctacggatggaaggcaaaaacagtaaagccgatgtggtgctg
gggctggataacaacctgttagacgccgccagtaaaaccggactgtttgccaaaagcggt
gtggcagcggatgccgttaacgttcccggcggctggaataatgacactttcgtaccgttt
gattatggctacttcgccttcgtttatgacaagaacaaactgaaaaacccgccacaaagc
ctgaaagaactggttgagagcgatcaaaactggcgggtgatttatcaggatccgcgcacc
agtacaccggggctgggtctgttgctatggatgcaaaaagtctatggcgatgacgcccca
caagcctggcagaaactggcgaagaaaacggtcacggtcaccaaaggctggagcgaagcc
tacggcctgtttttaaaaggtgaaagcgatctggtactgagttacaccacctctccggct
tatcacattctcgaagagaagaaagataactacgccgccgcgaacttcagcgaaggtcac
tatctgcaagtggaagtcgccgcccgcaccgctgccagcaagcagccggagctggcgcaa
aaattcctccagtttatggtttctccggctttccagaatgcgatcccaaccggcaactgg
atgtatccggtggcaaacgtcacgctgcctgccggttttgaaaaattgaccaaacccgca
accacgttggagttcacgccagccgaagtggcggcacaacgtcaggcatggattagcgaa
tggcaacgcgccgtcagccgttaa

DBGET integrated database retrieval system