KEGG   Escherichia coli K-12 MG1655: b0106Help
Entry
b0106             CDS       T00007                                 

Gene name
hofC
Definition
(RefSeq) assembly protein in type IV pilin biogenesis, transmembrane protein
  KO
K02505  
protein transport protein HofC
Organism
eco  Escherichia coli K-12 MG1655
Brite
Secretion system [BR:eco02044]
 Type II secretion system
  Type IVa pilus homolog protein
   b0106 (hofC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(114522..115724)
Genome map
AA seq 400 aa AA seqDB search
MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSLKRIAINSAQWRGDKS
AEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDLEQGIAFSNALLPWSEV
FPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSALRYPIIILAMAIMVVVAM
LHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVLFGFLLAIANKLLMRRPTW
LIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFLQGVESVRETMRCPYWVQLL
TQIQHDISNGQPIWLALKNTGEFSPLCLQLVRTGEASGSLDLMLDNLAHHHRENTMALAD
NLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGMG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtaagcaactctggcgctggcatggcataaccggcgacggcaatgcgcaagat
gggatgctatgggcagagagccgtactttactgcttatggcactacagcaacagatggtt
accccactaagcctgaagcgaatcgccatcaattctgcgcagtggcgaggagataaaagc
gcggaagtcattcatcaactggcgacgctactcaaagcagggttaacgctttctgaaggg
ctggctctgctggcggaacagcatcccagtaagcaatggcaagcgttgctgcaatcgctg
gcgcacgatctcgaacagggcattgctttttccaatgccttattaccctggtcagaggta
tttccgccgctctatcaggcgatgatccgcacgggtgaactgaccggtaagctggatgaa
tgctgctttgaactggcgcgtcagcaaaaagcccagcgtcagttgaccgacaaagtgaaa
tcagcgttacgttatcccatcatcattttagcgatggcaatcatggtggttgtggcaatg
ctgcattttgttctgccggagtttgccgctatctataagaccttcaacaccccactaccg
gcactaacgcaggggatcatgacgctggcagactttagtggcgaatggagctggctgctg
gtgttgttcggctttctgctggcgatagccaataagttgctgatgcgccgaccgacctgg
cttatagtgcggcagaaattgctgttacgcatcccgattatgggttcactgatgcgggga
caaaaactcacgcagatctttacgattctggcgctgacacaaagtgcaggcattactttt
ttacagggcgtagagagcgtcagagaaacaatgcgctgcccgtactgggtgcaacttctg
acacaaatccagcacgatatcagtaacggtcaacccatctggctggcgctaaaaaatacc
ggtgagtttagcccgctctgtttgcaattagtgagaacaggagaggcatccggctctctg
gatctcatgttagacaacctcgcccatcatcatcgggaaaacacaatggcgctggcggat
aacctcgcagccttactggaaccggcgttgctgatcataacgggaggaattattggtacg
ctggtggtggcaatgtatctgccaattttccatttaggcgatgcgatgagtgggatggga
taa

DBGET integrated database retrieval system