KEGG   Escherichia coli K-12 MG1655: b0109Help
Entry
b0109             CDS       T00007                                 

Gene name
nadC
Definition
(RefSeq) quinolinate phosphoribosyltransferase (EC:2.4.2.19)
  KO
K00767  
nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    b0109 (nadC)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     b0109 (nadC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(117752..118645)
Genome map
AA seq 297 aa AA seqDB search
MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDITAKLLPENSRSHATV
ITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQSLFELEGPSRVLLTGERT
ALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSALKYAVLCGGGANHRLGLS
DAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEELDEALKAGADIIMLDNFET
EQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVGALTKHVQALDLSMRFR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctcgccgctataaccctgacacccgacgtgacgagctgctggaacgcattaat
ctcgatatccccggcgcggtggcccaggcgctgcgggaagatttaggcggaacagtcgat
gccaacaatgatattacggcaaaacttttaccggaaaattctcgctctcatgccacggtg
atcacccgcgagaatggcgtcttttgcggcaaacgctgggttgaagaggtgtttattcaa
ctggcaggcgacgatgtcaccataatctggcatgtggatgacggcgatgtcatcaatgcc
aatcaatccttgttcgaacttgaaggcccatcccgcgtgctgttaacgggcgaacgcact
gcgcttaattttgtgcaaaccctttcaggagttgccagtaaggtacgccactatgtcgaa
ttgctggaaggcaccaacacgcagttgttggatacgcgcaaaaccttacccggcctgcgt
tcagctctgaaatacgcggtactttgcggcggcggagcgaatcaccgtctggggctttct
gatgccttcctgatcaaagaaaaccatattattgcctccggctcagtgcgccaggcggtc
gaaaaagcgtcctggctgcacccggatgcgccagtagaagtcgaagtagagaatctggaa
gaacttgatgaagccctgaaagcaggagccgatatcatcatgctggataacttcgaaaca
gaacagatgcgcgaagccgtcaaacgcaccaacggcaaggcgctactggaagtgtctggc
aacgtcactgacaaaacactgcgtgaatttgccgaaacgggcgtggactttatctccgtc
ggtgcgctaactaaacacgtacaagcactcgacctttcaatgcgttttcgctaa

DBGET integrated database retrieval system