KEGG   Escherichia coli K-12 MG1655: b0111Help
Entry
b0111             CDS       T00007                                 

Gene name
ampE
Definition
(RefSeq) ampicillin resistance inner membrane protein; putative signaling protein in beta-lactamase regulation
  KO
K03807  AmpE protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AmpE IncA
Motif
Other DBs
NCBI-GeneID: 946678
NCBI-ProteinID: NP_414653
Pasteur: ampE
RegulonDB: ECK120000038
ECOCYC: EG10042
ASAP: ABE-0000382
UniProt: P0AE14
Position
119281..120135
Genome map
AA seq 284 aa AA seqDB search
MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLGMTIIAMGVTFLLLRA
LQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVP
AGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLMGYAFLRAWQYWLARYQT
PHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWFASLGDFHTSQYQVLTRLA
QFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYGALV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacgctatttacaaccttactggtgttaattttcgagcgcctgtttaagttgggcgag
cactggcagcttgatcatcgtcttgaagcgttctttcggcgggtgaaacatttttctctc
gggcgcacgttaggcatgaccattattgcgatgggcgtgacttttttactgttacgcgca
ttgcagggagtattgttcaacgttcccacgctactggtgtggctgctgattggtttgctg
tgtattggcgcaggtaaagttcgtcttcattatcatgcttatctgacagctgcttcacgt
aatgatagccatgcccgtgccacgatggctggcgaactcaccatgattcacggcgtcccg
gcaggctgcgacgaacgtgagtatttgcgtgagctgcaaaatgcattgctgtggattaac
tttcgtttttatcttgcaccgctgttctggctgattgtggggggaacctggggacccgtt
acgctgatggggtatgcgtttttgcgtgcatggcaatactggctggcgcgatatcagacg
ccgcatcatcgtttacagtccggcattgatgccgtgcttcatgtactggattgggtgccg
gttcgtcttgcgggtgtggtatatgccttgatcggtcatggtgagaaagcgttaccggcc
tggtttgcttcgctgggtgatttccatacttcgcagtatcaggtgttaacgcgtctggcg
cagttctctctggcgcgtgaaccgcatgtcgataaggtggagacgccgaaggcagcggtt
tcaatggcgaagaaaacctcgttcgtggtcgtggtggtgattgcactactgacgatttac
ggggcgttggtgtaa

DBGET integrated database retrieval system