KEGG   Escherichia coli K-12 MG1655: b0114Help
Entry
b0114             CDS       T00007                                 

Gene name
aceE
Definition
(RefSeq) pyruvate dehydrogenase, decarboxylase component E1, thiamine triphosphate-binding (EC:1.2.4.1)
  KO
K00163  
pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b0114 (aceE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b0114 (aceE)
   00020 Citrate cycle (TCA cycle)
    b0114 (aceE)
   00620 Pyruvate metabolism
    b0114 (aceE)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     b0114 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
123017..125680
Genome map
AA seq 887 aa AA seqDB search
MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVNVAAGTGISNY
INTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDV
CFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPH
PKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESK
GAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWGSRWD
ELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWAL
NRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGDAAEGKNIAHQVKKMNMDGVRH
IRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQKLHGYLPSRQPNFTEKLELPSLQ
DFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGCSWLAAATSYSTNNLPMIPFYIYY
SMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPEGAEEGIRKGIYKLETI
EGSKGKVQLLGSGSILRHVREAAEILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHP
LETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEIDKKVVADAIAKFNIDADKVNPRLA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgtttcccaaatgacgtggatccgatcgaaactcgcgactggctccaggcg
atcgaatcggtcatccgtgaagaaggtgttgagcgtgctcagtatctgatcgaccaactg
cttgctgaagcccgcaaaggcggtgtaaacgtagccgcaggcacaggtatcagcaactac
atcaacaccatccccgttgaagaacaaccggagtatccgggtaatctggaactggaacgc
cgtattcgttcagctatccgctggaacgccatcatgacggtgctgcgtgcgtcgaaaaaa
gacctcgaactgggcggccatatggcgtccttccagtcttccgcaaccatttatgatgtg
tgctttaaccacttcttccgtgcacgcaacgagcaggatggcggcgacctggtttacttc
cagggccacatctccccgggcgtgtacgctcgtgctttcctggaaggtcgtctgactcag
gagcagctggataacttccgtcaggaagttcacggcaatggcctctcttcctatccgcac
ccgaaactgatgccggaattctggcagttcccgaccgtatctatgggtctgggtccgatt
ggtgctatttaccaggctaaattcctgaaatatctggaacaccgtggcctgaaagatacc
tctaaacaaaccgtttacgcgttcctcggtgacggtgaaatggacgaaccggaatccaaa
ggtgcgatcaccatcgctacccgtgaaaaactggataacctggtcttcgttatcaactgt
aacctgcagcgtcttgacggcccggtcaccggtaacggcaagatcatcaacgaactggaa
ggcatcttcgaaggtgctggctggaacgtgatcaaagtgatgtggggtagccgttgggat
gaactgctgcgtaaggataccagcggtaaactgatccagctgatgaacgaaaccgttgac
ggcgactaccagaccttcaaatcgaaagatggtgcgtacgttcgtgaacacttcttcggt
aaatatcctgaaaccgcagcactggttgcagactggactgacgagcagatctgggcactg
aaccgtggtggtcacgatccgaagaaaatctacgctgcattcaagaaagcgcaggaaacc
aaaggcaaagcgacagtaatccttgctcataccattaaaggttacggcatgggcgacgcg
gctgaaggtaaaaacatcgcgcaccaggttaagaaaatgaacatggacggtgtgcgtcat
atccgcgaccgtttcaatgtgccggtgtctgatgcagatatcgaaaaactgccgtacatc
accttcccggaaggttctgaagagcatacctatctgcacgctcagcgtcagaaactgcac
ggttatctgccaagccgtcagccgaacttcaccgagaagcttgagctgccgagcctgcaa
gacttcggcgcgctgttggaagagcagagcaaagagatctctaccactatcgctttcgtt
cgtgctctgaacgtgatgctgaagaacaagtcgatcaaagatcgtctggtaccgatcatc
gccgacgaagcgcgtactttcggtatggaaggtctgttccgtcagattggtatttacagc
ccgaacggtcagcagtacaccccgcaggaccgcgagcaggttgcttactataaagaagac
gagaaaggtcagattctgcaggaagggatcaacgagctgggcgcaggttgttcctggctg
gcagcggcgacctcttacagcaccaacaatctgccgatgatcccgttctacatctattac
tcgatgttcggcttccagcgtattggcgatctgtgctgggcggctggcgaccagcaagcg
cgtggcttcctgatcggcggtacttccggtcgtaccaccctgaacggcgaaggtctgcag
cacgaagatggtcacagccacattcagtcgctgactatcccgaactgtatctcttacgac
ccggcttacgcttacgaagttgctgtcatcatgcatgacggtctggagcgtatgtacggt
gaaaaacaagagaacgtttactactacatcactacgctgaacgaaaactaccacatgccg
gcaatgccggaaggtgctgaggaaggtatccgtaaaggtatctacaaactcgaaactatt
gaaggtagcaaaggtaaagttcagctgctcggctccggttctatcctgcgtcacgtccgt
gaagcagctgagatcctggcgaaagattacggcgtaggttctgacgtttatagcgtgacc
tccttcaccgagctggcgcgtgatggtcaggattgtgaacgctggaacatgctgcacccg
ctggaaactccgcgcgttccgtatatcgctcaggtgatgaacgacgctccggcagtggca
tctaccgactatatgaaactgttcgctgagcaggtccgtacttacgtaccggctgacgac
taccgcgtactgggtactgatggcttcggtcgttccgacagccgtgagaacctgcgtcac
cacttcgaagttgatgcttcttatgtcgtggttgcggcgctgggcgaactggctaaacgt
ggcgaaatcgataagaaagtggttgctgacgcaatcgccaaattcaacatcgatgcagat
aaagttaacccgcgtctggcgtaa

DBGET integrated database retrieval system