KEGG   Escherichia coli K-12 MG1655: b0114Help
Entry
b0114             CDS       T00007                                 

Gene name
aceE
Definition
(RefSeq) pyruvate dehydrogenase, decarboxylase component E1, thiamine triphosphate-binding
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00020  Citrate cycle (TCA cycle)
eco00620  Pyruvate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
Module
eco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b0114 (aceE)
   00020 Citrate cycle (TCA cycle)
    b0114 (aceE)
   00620 Pyruvate metabolism
    b0114 (aceE)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     b0114 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transketolase_C PFO_beta_C
Motif
Other DBs
NCBI-GeneID: 944834
NCBI-ProteinID: NP_414656
Pasteur: aceE
RegulonDB: ECK120000021
ECOCYC: EG10024
ASAP: ABE-0000397
UniProt: P0AFG8
Structure
PDB: 

Jmol
Position
123017..125680
Genome map
AA seq 887 aa AA seqDB search
MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVNVAAGTGISNY
INTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDV
CFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPH
PKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESK
GAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWGSRWD
ELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWAL
NRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGDAAEGKNIAHQVKKMNMDGVRH
IRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQKLHGYLPSRQPNFTEKLELPSLQ
DFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGCSWLAAATSYSTNNLPMIPFYIYY
SMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPEGAEEGIRKGIYKLETI
EGSKGKVQLLGSGSILRHVREAAEILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHP
LETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEIDKKVVADAIAKFNIDADKVNPRLA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgtttcccaaatgacgtggatccgatcgaaactcgcgactggctccaggcg
atcgaatcggtcatccgtgaagaaggtgttgagcgtgctcagtatctgatcgaccaactg
cttgctgaagcccgcaaaggcggtgtaaacgtagccgcaggcacaggtatcagcaactac
atcaacaccatccccgttgaagaacaaccggagtatccgggtaatctggaactggaacgc
cgtattcgttcagctatccgctggaacgccatcatgacggtgctgcgtgcgtcgaaaaaa
gacctcgaactgggcggccatatggcgtccttccagtcttccgcaaccatttatgatgtg
tgctttaaccacttcttccgtgcacgcaacgagcaggatggcggcgacctggtttacttc
cagggccacatctccccgggcgtgtacgctcgtgctttcctggaaggtcgtctgactcag
gagcagctggataacttccgtcaggaagttcacggcaatggcctctcttcctatccgcac
ccgaaactgatgccggaattctggcagttcccgaccgtatctatgggtctgggtccgatt
ggtgctatttaccaggctaaattcctgaaatatctggaacaccgtggcctgaaagatacc
tctaaacaaaccgtttacgcgttcctcggtgacggtgaaatggacgaaccggaatccaaa
ggtgcgatcaccatcgctacccgtgaaaaactggataacctggtcttcgttatcaactgt
aacctgcagcgtcttgacggcccggtcaccggtaacggcaagatcatcaacgaactggaa
ggcatcttcgaaggtgctggctggaacgtgatcaaagtgatgtggggtagccgttgggat
gaactgctgcgtaaggataccagcggtaaactgatccagctgatgaacgaaaccgttgac
ggcgactaccagaccttcaaatcgaaagatggtgcgtacgttcgtgaacacttcttcggt
aaatatcctgaaaccgcagcactggttgcagactggactgacgagcagatctgggcactg
aaccgtggtggtcacgatccgaagaaaatctacgctgcattcaagaaagcgcaggaaacc
aaaggcaaagcgacagtaatccttgctcataccattaaaggttacggcatgggcgacgcg
gctgaaggtaaaaacatcgcgcaccaggttaagaaaatgaacatggacggtgtgcgtcat
atccgcgaccgtttcaatgtgccggtgtctgatgcagatatcgaaaaactgccgtacatc
accttcccggaaggttctgaagagcatacctatctgcacgctcagcgtcagaaactgcac
ggttatctgccaagccgtcagccgaacttcaccgagaagcttgagctgccgagcctgcaa
gacttcggcgcgctgttggaagagcagagcaaagagatctctaccactatcgctttcgtt
cgtgctctgaacgtgatgctgaagaacaagtcgatcaaagatcgtctggtaccgatcatc
gccgacgaagcgcgtactttcggtatggaaggtctgttccgtcagattggtatttacagc
ccgaacggtcagcagtacaccccgcaggaccgcgagcaggttgcttactataaagaagac
gagaaaggtcagattctgcaggaagggatcaacgagctgggcgcaggttgttcctggctg
gcagcggcgacctcttacagcaccaacaatctgccgatgatcccgttctacatctattac
tcgatgttcggcttccagcgtattggcgatctgtgctgggcggctggcgaccagcaagcg
cgtggcttcctgatcggcggtacttccggtcgtaccaccctgaacggcgaaggtctgcag
cacgaagatggtcacagccacattcagtcgctgactatcccgaactgtatctcttacgac
ccggcttacgcttacgaagttgctgtcatcatgcatgacggtctggagcgtatgtacggt
gaaaaacaagagaacgtttactactacatcactacgctgaacgaaaactaccacatgccg
gcaatgccggaaggtgctgaggaaggtatccgtaaaggtatctacaaactcgaaactatt
gaaggtagcaaaggtaaagttcagctgctcggctccggttctatcctgcgtcacgtccgt
gaagcagctgagatcctggcgaaagattacggcgtaggttctgacgtttatagcgtgacc
tccttcaccgagctggcgcgtgatggtcaggattgtgaacgctggaacatgctgcacccg
ctggaaactccgcgcgttccgtatatcgctcaggtgatgaacgacgctccggcagtggca
tctaccgactatatgaaactgttcgctgagcaggtccgtacttacgtaccggctgacgac
taccgcgtactgggtactgatggcttcggtcgttccgacagccgtgagaacctgcgtcac
cacttcgaagttgatgcttcttatgtcgtggttgcggcgctgggcgaactggctaaacgt
ggcgaaatcgataagaaagtggttgctgacgcaatcgccaaattcaacatcgatgcagat
aaagttaacccgcgtctggcgtaa

DBGET integrated database retrieval system