KEGG   Escherichia coli K-12 MG1655: b0120Help
Entry
b0120             CDS       T00007                                 

Gene name
speD
Definition
(RefSeq) S-adenosylmethionine decarboxylase (EC:4.1.1.50)
  KO
K01611  
S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    b0120 (speD)
   00330 Arginine and proline metabolism
    b0120 (speD)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     b0120 (speD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(134788..135582)
Genome map
AA seq 264 aa AA seqDB search
MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANRLTEILSETCSIIG
ANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPETVVAHLDKSHICVHTYP
ESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTIDYRVRGFTRDINGMKHF
IDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSE
RQEITAALWKEMREIYYGRNMPAV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaactgaaactgcatggctttaataatctgaccaaaagtctgagtttttgtatt
tacgatatctgctacgccaaaactgccgaagagcgcgacggttatattgcttatatcgat
gaactctataatgccaaccgtctgaccgaaatcctgtcagaaacctgttccattatcggg
gctaatattcttaacatcgcccgccaggattacgaaccacagggtgccagcgtcactatt
ctggtgagtgaagaaccggttgacccgaaactcatcgacaaaacagaacaccccggccca
ctgccagaaacggtcgttgcccatcttgataaaagtcatatttgcgtacatacctacccg
gaaagtcatcctgaaggcggtttatgtaccttccgcgccgatattgaagtctctacctgc
ggcgtgatttctccgctgaaggcgctgaattacctgatccaccagcttgagtccgatatc
gtaaccattgattatcgcgtgcgcggttttacccgcgacattaacggtatgaagcacttt
atcgaccatgagattaattcgattcagaactttatgtctgacgatatgaaggcgctgtat
gacatggtggatgtgaacgtctatcaggaaaatatcttccataccaagatgttgcttaaa
gagttcgaccttaagcactacatgttccacaccaaaccggaagacttaaccgacagcgag
cgccaggaaattaccgctgcgctgtggaaagaaatgcgcgagatttattacgggcgcaat
atgccagctgtttaa

DBGET integrated database retrieval system