KEGG   Escherichia coli K-12 MG1655: b0121Help
Entry
b0121             CDS       T00007                                 

Gene name
speE
Definition
(RefSeq) spermidine synthase (putrescine aminopropyltransferase) (EC:2.5.1.16)
  KO
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Glutathione metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    b0121 (speE)
   00330 Arginine and proline metabolism
    b0121 (speE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    b0121 (speE)
   00480 Glutathione metabolism
    b0121 (speE)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     b0121 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(135598..136464)
Genome map
AA seq 288 aa AA seqDB search
MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQY
LPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDND
ALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQPS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaaaaacagtggcatgaaacgctacacgaccagtttgggcagtactttgcg
gtagataacgttctgtatcatgaaaagaccgatcaccaggatctgatcatttttgagaac
gctgcatttggtcgcgtaatggcgctggatggcgtagtacaaaccaccgagcgcgacgag
tttatctatcatgagatgatgacccatgttccgctactggcccatggtcacgcgaaacat
gtgctgattatcggcggcggcgacggtgccatgctgcgtgaagtaacccgacataaaaac
gttgagtcaatcacgatggtggaaatcgatgcgggtgtcgtatcgttctgccgtcagtat
ctacccaaccataacgccggtagctacgacgatccgcgctttaagctggtgatcgacgat
ggcgtcaatttcgttaatcaaaccagccagacctttgatgtcattatctccgactgcacc
gatcctatcggtcccggcgaaagccttttcacttcggcattttatgaaggctgcaaacgt
tgcctgaatcctggcggtatcttcgtcgcacaaaacggcgtctgctttttacagcaggaa
gaagccatcgacagccatcgcaaactcagccattacttcagcgacgttggcttttatcag
gcggcgatcccgacctattacggcggtatcatgacttttgcatgggcgacagataacgac
gccttacgccatctctcaaccgaaattattcaggcgcgttttctcgcctctggcctgaaa
tgccgttattacaatccggcaatccatacggcagcttttgccttacctcagtatctgcaa
gacgcactggcttcacagccgtcctaa

DBGET integrated database retrieval system