KEGG   Escherichia coli K-12 MG1655: b0123Help
Entry
b0123             CDS       T00007                                 

Gene name
cueO
Definition
(RefSeq) multicopper oxidase (laccase)
  KO
K14588  
blue copper oxidase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
137083..138633
Genome map
AA seq 516 aa AA seqDB search
MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFG
GKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIP
PGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDD
VPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCN
ARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPV
SQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLD
MMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKP
MFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVS
EVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgtcgtgatttcttaaaatattccgtcgcgctgggtgtggcttcggctttgccg
ctgtggagccgcgcagtatttgcggcagaacgcccaacgttaccgatccctgatttgctc
acgaccgatgcccgtaatcgcattcagttaactattggcgcaggccagtccacctttggc
gggaaaactgcaactacctggggctataacggcaatctgctggggccggcggtgaaatta
cagcgcggcaaagcggtaacggttgatatctacaaccaactgacggaagagacaacgttg
cactggcacgggctggaagtaccgggtgaagtcgacggcggcccgcagggaattattccg
ccaggtggcaagcgctcggtgacgttgaacgttgatcaacctgccgctacctgctggttc
catccgcatcagcacggcaaaaccgggcgacaggtggcgatggggctggctgggctggtg
gtgattgaagatgacgagatcctgaaattaatgctgccaaaacagtggggtatcgatgat
gttccggtgatcgttcaggataagaaatttagcgccgacgggcagattgattatcaactg
gatgtgatgaccgccgccgtgggctggtttggcgatacgttgctgaccaacggtgcaatc
tacccgcaacacgctgccccgcgtggttggctgcgcctgcgtttgctcaatggctgtaat
gcccgttcgctcaatttcgccaccagcgacaatcgcccgctgtatgtgattgccagcgac
ggtggtctgctacctgaaccagtgaaggtgagcgaactgccggtgctgatgggcgagcgt
tttgaagtgctggtggaggttaacgataacaaaccctttgacctggtgacgctgccggtc
agccagatggggatggcgattgcgccgtttgataagcctcatccggtaatgcggattcag
ccgattgctattagtgcctccggtgctttgccagacacattaagtagcctgcctgcgtta
ccttcgctggaagggctgacggtacgcaagctgcaactctctatggacccgatgctcgat
atgatggggatgcagatgctaatggagaaatatggcgatcaggcgatggccgggatggat
cacagccagatgatgggccatatggggcacggcaatatgaatcatatgaaccacggcggg
aagttcgatttccaccatgccaacaaaatcaacggtcaggcgtttgatatgaacaagccg
atgtttgcggcggcgaaagggcaatacgaacgttgggttatctctggcgtgggcgacatg
atgctgcatccgttccatatccacggcacgcagttccgtatcttgtcagaaaatggcaaa
ccgccagcggctcatcgcgcgggctggaaagataccgttaaggtagaaggtaatgtcagc
gaagtgctggtgaagtttaatcacgatgcaccgaaagaacatgcttatatggcgcactgc
catctgctggagcatgaagatacggggatgatgttagggtttacggtataa

DBGET integrated database retrieval system