KEGG   Escherichia coli K-12 MG1655: b0136Help
Entry
b0136             CDS       T00007                                 

Gene name
yadK
Definition
(RefSeq) putative fimbrial-like adhesin protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial
Motif
Other DBs
NCBI-GeneID: 944835
NCBI-ProteinID: NP_414678
Pasteur: yadK
RegulonDB: ECK120002200
ECOCYC: EG12325
ASAP: ABE-0000472
UniProt: P37016
Position
complement(151003..151599)
Genome map
AA seq 198 aa AA seqDB search
MHPTQRKLMKRIILFLSLLFCIACPAIAGQDIDLVANVKNSTCKSGISNQGNIDLGVVGV
GYFSGNVTPESYQPGGKEFTITVSDCALQGTGDVLNQLHIDFRALSGVMAAGSRQIFANE
ISSGASNVGVVIFSTQDSANTFNVLNASGGSRSVYPVMSDDMNGSSWKFSTRMQKIDPAL
SVTSGQLMSHVLVDIYYE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccactcaacgtaagctgatgaagagaataattctgtttctgtcattactgttt
tgcatcgcctgtccagccattgctggacaggatattgaccttgttgccaatgtaaaaaac
agcacctgcaaaagcggaatcagtaaccagggtaatattgatcttggcgtcgttggggtg
ggatatttttcaggtaatgttactcctgaaagttatcaaccaggtggaaaagagttcact
atcactgtatccgactgtgcattacagggaactggcgatgtgctaaatcagttacatatt
gattttagagcccttagcggtgtcatggctgctggctctaggcaaatatttgctaatgaa
atttcgtcaggagcaagtaatgtaggagtagttatattttctactcaggattcggcgaat
acattcaatgttcttaatgcttcaggcggatctcgttccgtttatccagtaatgtcggat
gacatgaatggttcatcctggaaatttagcacccgaatgcaaaaaatcgatcctgcattg
agtgttacatctggtcaacttatgagccatgtgttagtggatatttactacgaataa

DBGET integrated database retrieval system