KEGG   Escherichia coli K-12 MG1655: b0139Help
Entry
b0139             CDS       T00007                                 

Gene name
htrE
Definition
(RefSeq) putative outer membrane usher protein
  KO
K07347  
outer membrane usher protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0139 (htrE)
Secretion system [BR:eco02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   b0139 (htrE)
Bacterial motility proteins [BR:eco02035]
 Pilus system
  Fimbrial proteins
   b0139 (htrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(152829..155426)
Genome map
AA seq 865 aa AA seqDB search
MTIEYTKNYHHLTRIATFCALLYCNTAFSAELVEYDHTFLMGQNASNIDLSRYSEGNPAI
PGVYDVSVYVNDQPIINQSITFVAIEGKKNAQACITLKNLLQFHINSPDINNEKAVLLAR
DETLGNCLNLTEIIPQASVRYDVNDQRLDIDVPQAWVMKNYQNYVDPSLWENGINAAMLS
YNLNGYHSETPGRKNESIYAAFNGGMNLGAWRLRASGNYNWMTDSGSNYDFKNRYVQRDI
ASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTLASFAPIIHGVANTNAKVTIT
QGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTIEESDGSKRTFSQPFSSVVQMLRPGVG
RWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTGIQITDNNYTAGLLGLGLNTSVG
AFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETSTSLNIAAYRYSTQNYLGLNDALTL
IDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKFEKKDYGSFYLSGSWSDYWASGQNR
SNYSIGYSNSTSWGSYSVSAQRSWNEDGDTDDSVYLSFTIPIEKLLGTEQRTSGFQSIDT
QISSDFKGNNQLNVSSSGYSDNARVSYSVNTGYTMNKASKDLSYVGGYASYESPWGTLAG
SISANSDNSRQVSLSTDGGFVLHSGGLTFSNDSFSDSDTLAVVQAPGAQGARINYGNSTI
DRWGYGVTSALSPYHENRIALDINDLENDVELKSTSAVAVPRQGSVVFADFETVQGQSAI
MNITRSDGKNIPFAADIYDEQGNVIGNVGQGGQAFVRGIEQQGNISIKWLEQSKPVSCLA
HYQQSPEAEKIAQSIILNGIRCQIQ
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
gtgactatagaatatactaaaaattatcatcatctgacccgtatcgccacgttttgcgcg
ctgctgtattgcaatactgctttcagtgctgaactcgttgaatatgaccataccttcctg
atggggcagaatgcatctaatattgatctcagccggtacagtgaaggtaaccccgctata
ccgggtgtttacgacgtcagtgtttatgtaaacgaccaaccaatcattaaccaaagtatt
acatttgtcgcaattgaaggaaaaaagaacgcccaggcttgtatcacattaaagaattta
ttgcagtttcatattaattctcccgatataaataacgaaaaagccgttctgcttgccagg
gatgaaacgctcggcaattgcctcaatttgacggaaattatccctcaggcttctgttcgt
tatgacgttaacgatcaacgtctggatatagacgttcctcaagcctgggtaatgaaaaat
taccaaaactatgttgatccatcgttatgggaaaacggcattaatgcggccatgttgtca
tacaacctcaacggatatcatagtgaaacccctggtcgaaaaaatgaaagcatttatgct
gcatttaacggtgggatgaatttaggtgcatggcgactgcgtgcctcgggcaactacaac
tggatgaccgattctggcagtaattatgattttaagaatcggtatgttcagcgtgatatc
gcctcgctgcgttctcaactcattcttggtgagtcttatacgacgggcgaaacctttgat
tccgtcagtatccgaggcattcgtttatacagtgacagccgcatgttgcctccgacttta
gccagctttgcgcctatcattcatggcgttgccaataccaacgccaaagtcactattacg
caaggtggctataagatttatgaaacgacggtgccgccaggcgctttcgtcattgatgat
ctgagtccgtcagggtacggcagcgatcttattgttaccatcgaagaatccgatggctca
aagcggacattctcgcaacctttctcatccgttgttcaaatgttacgccctggcgttgga
cgttgggatattagcggcggtcaggtcttaaaagatgatattcaggatgagcctaattta
tttcaagcaagctactactacggcctgaataactatctgacgggttataccggtattcag
ataaccgataataactataccgctggtttgttaggtcttggtctgaatacttcagttggt
gcattttctttcgatgtgactcattccaatgttcgtatcccggatgataaaacataccag
gggcaaagttatcgtgtttcctggaacaagttattcgaagaaacaagtacttcactgaat
atcgcggcctatcgctattcgacacagaattaccttggtcttaatgatgcactaactcta
attgatgaagtgaaacatcccgaacaagatcttgaaccgaaatccatgcgtaattactca
cgcatgaaaaatcaggttacggtcagtattaaccaaccgttgaaatttgagaaaaaagat
tacggttcattttatctttccggaagttggtccgattactgggcttccggacaaaatcgt
agcaattactctattggctacagtaacagtacatcctggggcagctacagtgtcagtgcc
cagcgttcatggaatgaagacggcgacactgacgatagcgtttatcttagtttcaccatt
ccaattgaaaaattacttggcactgaacaacgtacttcaggtttccagagtattgatact
caaataagcagtgactttaagggtaataaccaactcaacgttagcagcagtggctatagc
gataacgctcgcgtcagttatagcgtgaatactggctatacgatgaataaagccagcaaa
gatttgagttatgttgggggttatgccagctatgagtcaccatggggaacgctggcaggt
tcaatttctgcaaatagcgataacagccgtcaagtttctctcagcaccgacggtggtttt
gtattgcatagcggtggactgactttcagtaatgatagttttagcgactccgatacactg
gcggtagttcaggctccaggtgctcaaggagcgcgaataaattatggcaacagtactatc
gatcgatggggttatggtgtcaccagcgctctttctccttatcatgaaaaccgtatcgcg
ctggatatcaacgatcttgagaacgatgttgaattaaaaagtaccagtgcagtagctgta
ccgcgtcagggttcagtcgtctttgctgattttgaaaccgtgcaagggcaatcagccatt
atgaacatcacacgaagtgatggtaaaaatattccatttgctgcagatatttatgatgag
caaggcaatgtcattggtaatgttggacagggtggacaagcatttgttcgtggtattgag
cagcagggaaatatcagcattaaatggctcgaacaaagtaaacccgtaagttgtcttgcg
cattatcaacaaagcccagaagcagaaaaaatagcacaatctattattctgaatggaatt
cggtgtcagattcagtaa

DBGET integrated database retrieval system