KEGG   Escherichia coli K-12 MG1655: b0140Help
Entry
b0140             CDS       T00007                                 

Gene name
yadV
Definition
(RefSeq) putative periplasmic pilin chaperone
  KO
K15540  chaperone protein EcpD
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PapD_N PapD_C
Motif
Other DBs
NCBI-GeneID: 944859
NCBI-ProteinID: NP_414682
Pasteur: ecpD
RegulonDB: ECK120001898
ECOCYC: EG11973
ASAP: ABE-0000482
UniProt: P33128
Structure
PDB: 

Jmol
Position
complement(155461..156201)
Genome map
AA seq 246 aa AA seqDB search
MFFNTKHTTALCFVTCMAFSSSSIADIVISGTRVIYKSDQKSVNVRLENKGNNPLLVQSW
LDTGDDNAEPGSITVPFTATPPVSRIDAKRGQTIKLMYTASTSLPKDRESVFWFNVLEVP
PKPDAEKVANQSLLQLAFRTRIKLFYRPDGLKGNPSEAPLALKWFWSGSEGKASLRVTNP
TPYYVSFSSGDLEASGKRYPIDVKMIAPFSDEVMKVNGLNGKANSAKVHFYAINDFGGAI
EGNARL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaacaccaaacatacaacagctttatgcttcgtaacctgtatggcttttagt
tcatcgtctattgcggacattgtcatttcgggtactcgcgtaatatataaaagcgatcaa
aaaagtgtcaacgtacgtctggaaaataaagggaataacccgttgcttgtccagagttgg
ttagatactggcgatgacaacgctgagcctggcagtattacagtcccttttactgctacg
ccgccagtatcgcgtattgatgccaaacgtgggcaaacaatcaaattaatgtacacagcc
agcacctcactgcctaaagacagagagagcgtgttctggtttaacgtactggaagttcca
ccaaaaccagatgcagaaaaggtcgcgaatcaaagcctgctgcaactggcatttcgcaca
cgtataaaacttttctatcgcccggatggattgaagggaaatccctctgaagccccgtta
gccctgaagtggttctggtcaggttcagaaggtaaggcgtcattacgagtgaccaatcca
accccttactacgtctcttttagcagtggtgatttagaagctagcggtaaacgctatccg
attgatgtgaaaatgattgcaccatttagtgatgaggtcatgaaagtcaatggccttaat
ggcaaagcgaattctgcaaaagtgcatttttacgccattaatgactttggtggcgcaatt
gaaggtaatgccaggctgtaa

DBGET integrated database retrieval system