KEGG   Escherichia coli K-12 MG1655: b0142Help
Entry
b0142             CDS       T00007                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eco00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(157253..157732)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttaccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaacgcagccgtggcg
ctggaaacctctcttgcacctgaagagctactcaatcacacacagcgtattgaattgcag
caaggtcgcgtccgcaaagctgaacgctggggaccacgcacgctggatctcgacatcatg
ctgtttggtaatgaagtgataaatactgaacgcctgaccgttccgcactacgatatgaag
aatcgtggatttatgctgtggccgctgtttgaaatcgcgccggagttggtgtttcctgat
ggggagatgttgcgtcaaatcttacatacaagagcatttgacaaattaaacaaatggtaa

DBGET integrated database retrieval system