KEGG   Escherichia coli K-12 MG1655: b0143Help
Entry
b0143             CDS       T00007                                 

Gene name
pcnB
Definition
(RefSeq) poly(A) polymerase (EC:2.7.7.19)
  KO
K00970  
poly(A) polymerase [EC:2.7.7.19]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b0143 (pcnB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     b0143 (pcnB)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     b0143 (pcnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(157729..159126)
Genome map
AA seq 465 aa AA seqDB search
MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLNKAGY
EAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEV
ATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDY
VGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLND
IPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPMERIIEQVLK
NTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMNDVLDEACRSL
AIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEVERNAELQRLV
KWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atttttacccgagtcgctaatttttgccgcaaggtgctaagccgcgaggaaagcgaggct
gaacaggcagtcgcccgtccacaggtgacggtgatcccgcgtgagcagcatgctatttcc
cgcaaagatatcagtgaaaatgccctgaaggtaatgtacaggctcaataaagcgggatac
gaagcctggctggttggcggcggcgtgcgcgacctgttacttggcaaaaagccgaaagat
tttgacgtaaccactaacgccacgcctgagcaggtgcgcaaactgttccgtaactgccgc
ctggtgggtcgccgtttccgtctggctcatgtaatgtttggcccggagattatcgaagtt
gcgaccttccgtggacaccacgaaggtaacgtcagcgaccgcacgacctcccaacgcggg
caaaacggcatgttgctgcgcgacaacattttcggctccatcgaagaagacgcccagcgc
cgcgatttcactatcaacagcctgtattacagcgtagcggattttaccgtccgtgattac
gttggcggcatgaaggatctgaaggacggcgttatccgtctgattggtaacccggaaacg
cgctaccgtgaagatccggtacgtatgctgcgcgcggtacgttttgccgccaaattgggt
atgcgcatcagcccggaaaccgcagaaccgatccctcgcctcgctaccctgctgaacgat
atcccaccggcacgcctgtttgaagaatcgcttaaactgctacaagcgggctacggttac
gaaacctataagctgttgtgtgaatatcatctgttccagccgctgttcccgaccattacc
cgctacttcacggaaaatggcgacagcccgatggagcggatcattgaacaggtgctgaag
aataccgatacgcgtatccataacgatatgcgcgtgaacccggcgttcctgtttgccgcc
atgttctggtacccactgctggagacggcacagaagatcgcccaggaaagcggcctgacc
tatcacgacgctttcgcgctggcgatgaacgacgtgctggacgaagcctgccgttcactg
gcaatcccgaaacgtctgacgacattaacccgcgatatctggcagttgcagttgcgtatg
tcccgtcgtcagggtaaacgcgcatggaaactgctggagcatcctaagttccgtgcggct
tatgacctgttggccttgcgagctgaagttgagcgtaacgctgaactgcagcgtctggtg
aaatggtggggtgagttccaggtttccgcgccaccagaccaaaaagggatgctcaacgag
ctggatgaagaaccgtcaccgcgtcgtcgtactcgtcgtccacgcaaacgcgcaccacgt
cgtgagggtaccgcatga

DBGET integrated database retrieval system