KEGG   Escherichia coli K-12 MG1655: b0150Help
Entry
b0150             CDS       T00007                                 

Gene name
fhuA
Definition
(RefSeq) ferrichrome outer membrane transporter
  KO
K02014  
iron complex outermembrane recepter protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0150 (fhuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
167484..169727
Genome map
AA seq 747 aa AA seqDB search
MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVTAAPAPQESAWGPAAT
IAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGTRGASNTY
DHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGG
LLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKG
SEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFN
EGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSK
QCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDI
NAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLV
TLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVG
KDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRA
RGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPL
SGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDRE
YVASCFNTYGCFWGAERQVVATATFRF
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgttccaaaactgctcagccaaaacactcactgcgtaaaatcgcagttgtagta
gccacagcggttagcggcatgtctgtttatgcacaggcagcggttgaaccgaaagaagac
actatcaccgttaccgctgcacctgcgccgcaagaaagcgcatgggggcctgctgcaact
attgcggcgcgacagtctgctaccggcactaaaaccgatacgccgattcaaaaagtgcca
cagtctatttctgttgtgaccgccgaagagatggcgctgcatcagccgaagtcggtaaaa
gaagcgcttagctacacgccgggtgtctctgttggtacgcgtggcgcatccaacacctat
gaccacctgatcattcgcggctttgcggcagaaggccaaagccagaataactatctgaat
ggcctgaagttgcagggcaacttctataacgatgcggtcattgacccgtatatgctggaa
cgcgctgaaattatgcgtggcccggtttccgtgctttacggtaaaagcagtcctggcggc
ctgttgaatatggtcagcaagcgtccgaccaccgaaccgctgaaagaagttcagtttaaa
gccggtactgacagcctgttccagactggttttgactttagcgattcgttggatgatgac
ggtgtttactcttatcgcctgaccggtcttgcgcgttctgccaatgcccagcagaaaggg
tcagaagagcagcgttatgctattgcaccggcgttcacctggcgtccggatgataaaacc
aattttaccttcctttcttacttccagaacgagccggaaaccggttattacggctggttg
ccgaaagagggaaccgttgagccgctgccgaacggtaagcgtctgccgacagactttaat
gaaggggcgaagaacaacacctattctcgtaatgagaagatggtcggctacagcttcgat
cacgaatttaacgacacctttactgtgcgtcagaacctgcgctttgctgaaaacaaaacc
tcgcaaaacagcgtttatggttacggcgtctgctccgatccggcgaatgcttacagcaaa
cagtgtgcggcattagcgccagcggataaaggccattatctggcacgtaaatacgtcgtt
gatgatgagaagctgcaaaacttctccgttgatacccagttgcagagcaagtttgccact
ggcgatatcgaccacaccctgctgaccggtgtcgactttatgcgtatgcgtaatgacatc
aacgcctggtttggttacgacgactctgtgccactgctcaatctgtacaatccggtgaat
accgatttcgacttcaatgccaaagatccggcaaactccggcccttaccgcattctgaat
aaacagaaacaaacgggcgtttatgttcaggatcaggcgcagtgggataaagtgctggtc
accctaggcggtcgttatgactgggcagatcaagaatctcttaaccgcgttgccgggacg
accgataaacgtgatgacaaacagtttacctggcgtggtggtgttaactacctgtttgat
aatggtgtaacaccttacttcagctatagcgaatcgtttgaaccttcttcgcaagttggg
aaggatggtaatattttcgcaccgtctaaaggtaagcagtatgaagtcggcgtgaaatat
gtaccggaagatcgtccgattgtagttactggtgccgtgtataatctcactaaaaccaac
aacctgatggcggaccctgagggttccttcttctcggttgaaggtggcgagatccgcgca
cgtggcgtagaaatcgaagcgaaagcggcgctgtcggcgagtgttaacgtagtcggttct
tatacttacaccgatgcggaatacaccaccgatactacctataaaggcaatacgcctgca
caggtgccaaaacacatggcttcgttgtgggctgactacaccttctttgacggtccgctt
tcaggtctgacgctgggcaccggtggtcgttatactggctccagttatggtgatccggct
aactcctttaaagtgggaagttatacggtcgtggatgcgttagtacgttatgatctggcg
cgagtcggcatggctggctccaacgtggcgctgcatgttaacaacctgttcgatcgtgaa
tacgtcgccagctgctttaacacttatggctgcttctggggcgcagaacgtcaggtcgtt
gcaaccgcaaccttccgtttctaa

DBGET integrated database retrieval system