KEGG   Escherichia coli K-12 MG1655: b0151Help
Entry
b0151             CDS       T00007                                 

Gene name
fhuC
Definition
(RefSeq) iron(3+)-hydroxamate import ABC transporter ATPase
  KO
K02013  iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0151 (fhuC)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     b0151 (fhuC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    b0151 (fhuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_15 AAA_23 AAA_22 BCA_ABC_TP_C RsgA_GTPase AAA_16 AAA_33 AAA_25
Motif
Other DBs
NCBI-GeneID: 945250
NCBI-ProteinID: NP_414693
Pasteur: fhuC
RegulonDB: ECK120000298
ECOCYC: EG10304
ASAP: ABE-0000522
UniProt: P07821
Position
169778..170575
Genome map
AA seq 265 aa AA seqDB search
MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLGRH
QPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRELVAIGRYPWHGALGRF
GAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDI
AHQVDVLSLVHRLSQERGLTVIAVLHDINMAARYCDYLVALRGGEMIAQGTPAEIMRGET
LEMIYGIPMGILPHPAGAAPVSFVY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaatacacgaatcattccgataccacttttgcactgcgtaatatctcctttcgt
gtgcccgggcgcacgcttttgcatccgctgtcgttaacctttcctgccgggaaagtgacc
ggtctgattggtcacaacggttctggtaaatccactctgctcaaaatgcttggccgtcat
cagccgccgtcggaaggggagattcttcttgatgcccaaccgctggaaagctggagcagc
aaagcgtttgcccgcaaagtggcttatttgccgcagcagcttcctccggcagaagggatg
accgtgcgtgaactggtggcgattggtcgttacccgtggcatggcgcgctggggcgcttt
ggggcggcagatcgcgaaaaagtcgaggaagctatctcgctggttggcttaaaaccgctg
gcgcatcggctggtcgatagtctctctggcggcgaacgtcagcgggcgtggatcgccatg
ctggtggcgcaggatagccgttgtctgttgctcgacgaaccgacctcggcgctggatatc
gcccaccaggttgatgtgctgtcgctggtgcaccgtttaagtcaggagcgtggcctgacg
gtcattgccgtgttgcacgatatcaatatggcggcacgctactgtgattatctggtcgcc
ctgcgcggcggtgaaatgattgctcagggaacgcctgcggaaattatgcgcggcgaaacc
ctcgaaatgatttatggcatcccgatgggtattttgccgcatccggcgggtgctgcacct
gtgagttttgtttattga

DBGET integrated database retrieval system