KEGG   Escherichia coli K-12 MG1655: b0152Help
Entry
b0152             CDS       T00007                                 

Gene name
fhuD
Definition
(RefSeq) iron-hydroxamate transporter subunit
  KO
K02016  
iron complex transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0152 (fhuD)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    b0152 (fhuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
170575..171465
Genome map
AA seq 296 aa AA seqDB search
MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLPVELLLALGIVPYGVA
DTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGR
GFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLT
TLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDH
DNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIGGKA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcttacctcttatttcgcgccgtcgactgttaacggcgatggcgctttctccg
ttgttatggcagatgaataccgcccacgcggcggctattgatcccaatcgtattgtggcg
ctggagtggttgccggtggaattactgctggcgctcggcatcgtgccttacggcgtggcg
gataccatcaactatcgcctgtgggtcagcgaaccaccattgccggactcagtgatcgac
gtcggtttgcgcacagaacctaaccttgaactgctgaccgaaatgaaaccatcgtttatg
gtctggtcggcaggatatggcccttcaccagaaatgctggctcgtattgcgccgggtcgc
ggatttaacttcagtgacggcaaacagccgttggcgatggcgcgtaaatcgctgacggaa
atggcagatttacttaacctgcaaagcgcagcggaaacgcatttagcgcaatatgaagac
tttatccgcagcatgaaaccccgctttgtgaagcgtggtgcgcgtccgttattgctgacg
acgcttatcgatccgcgccatatgctggtcttcggtccaaacagcttgttccaggaaatt
cttgatgagtacggcatcccaaatgcctggcaaggggaaaccaacttctggggcagtacc
gccgtcagtatcgatcgtctggcggcgtataaagacgttgatgtgctctgttttgatcac
gacaacagcaaagacatggatgcgctaatggcaacgccgctgtggcaggccatgccgttt
gtccgcgccggacgctttcagcgcgtacctgcagtctggttttatggtgcgacgctctcg
gcaatgcactttgtgcgcgttctggataacgccatcggaggtaaagcgtga

DBGET integrated database retrieval system