KEGG   Escherichia coli K-12 MG1655: b0154Help
Entry
b0154             CDS       T00007                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde aminotransferase (aminomutase) (EC:5.4.3.8)
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    b0154 (hemL)
Enzymes [BR:eco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     b0154 (hemL)
Amino acid related enzymes [BR:eco01007]
 Aminotransferase (transaminase)
  Class III
   b0154 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(173602..174882)
Genome map
AA seq 426 aa AA seqDB search
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKYTLTCT
YNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAEEAGIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFEAGFMSVAHSMEDINNTIDAAR
RVFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctgaaaatctttacagcgcagcgcgcgagctgatccctggcggtgtgaac
tcccctgttcgcgcctttactggcgtgggcggcactccactgtttatcgaaaaagcggac
ggcgcttatctgtacgatgttgatggcaaagcctatatcgattatgtcggttcctggggg
ccgatggtgctgggccataaccatccggcaatccgcaatgccgtgattgaagccgccgag
cgtggtttaagctttggtgcaccaaccgaaatggaagtgaaaatggcgcaactggtgacc
gaactggtcccgaccatggatatggtgcgcatggtgaactccggcactgaagcgaccatg
agcgccatccgcctggcccgtggttttaccggtcgcgacaaaattattaaatttgaaggg
tgttaccatggtcacgctgactgcctgctggtgaaagccggttctggcgcactcacgtta
ggccagccaaactcgccgggcgttccggcagatttcgccaaatataccttaacctgtact
tataatgatctggcttctgtacgcgccgcatttgagcaatacccgcaagagattgcctgt
attatcgtcgagccggtggcaggcaatatgaactgtgttccgccgctgccagagttcctg
ccaggtctgcgcgcgctgtgcgacgaatttggcgcgttgctgatcatcgatgaagtgatg
accggtttccgcgtagcgctagctggcgcacaggattattacggcgtagtgccagattta
acctgcctcggcaaaatcatcggcggtggaatgccggtaggcgcattcggtggtcgtcgt
gatgtaatggatgcgctggccccgacgggtccggtctatcaggcgggtacgctttccggt
aacccgattgcgatggcagcgggtttcgcctgtctgaatgaagtcgcgcagccgggcgtt
cacgaaacgctggatgagctgacaacacgtctggcagaaggtctgctggaagcggcagaa
gaagccggaattccgctggtcgttaaccacgttggcggcatgttcggtattttctttacc
gacgccgagtccgtgacgtgctatcaggatgtgatggcctgtgacgtggaacgctttaag
cgtttcttccatatgatgctggacgaaggtgtttacctggcaccgtcagcgtttgaagcg
ggctttatgtccgtggcgcacagcatggaagatatcaataacaccatcgatgctgcacgt
cgggtgtttgcgaagttgtga

DBGET integrated database retrieval system