KEGG   Escherichia coli K-12 MG1655: b0155Help
Entry
b0155             CDS       T00007                                 

Gene name
clcA
Definition
(RefSeq) H(+)/Cl(-) exchange transporter
  KO
K03281  
chloride channel protein, CIC family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
175107..176528
Genome map
AA seq 473 aa AA seqDB search
MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTLVGLAAVAFDKGVAWL
QNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPEIEGALEDQR
PVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVLDIFRLKGDEARHTLLAT
GAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGVIMSTIMYRIFNHEVALID
VGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKWVLMGGAIGG
LCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPM
LALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQ
LILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEAEQLARSKAASASENT
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgatactccctctttagaaacaccgcaggccgcgcgcctgcgacgcagacaa
ctgattcgccaacttcttgagcgcgataaaaccccgttagccattttgtttatggcggca
gtcgtcggcacgcttgttgggctggcagcggttgcttttgacaaaggtgtcgcctggttg
cagaaccaacgtatgggggcgctggtacatactgctgataattatccgcttctgttaacc
gtcgcttttctctgttcggcggtgctggcgatgtttggctactttttggtgcgcaaatac
gcgccggaagcaggtggttcggggatcccggaaattgaaggggcgctggaagatcaacgt
cccgttcgctggtggcgtgtattgccggtgaagttctttggcgggctggggacactcggc
ggaggcatggtgttggggcgcgaagggccaaccgtgcagatcggcggtaacattggccgt
atggtgcttgatattttccgcctgaaaggtgacgaagctcgccatacgctgctggcaacc
ggtgctgctgcggggctggctgcggcctttaacgcgccgctggcgggtattttgtttatt
atcgaagagatgcgtccgcagtttcgctatacgttaatttcgattaaagcggtatttatt
ggtgtcattatgtcgaccattatgtaccggatttttaatcatgaagttgcgttgattgac
gtcggtaaactttctgatgcgccgcttaatacgctgtggctttatctgatcctcggtatt
atttttggcattttcggccctatttttaataaatgggtgctggggatgcaggatttgctg
caccgtgtgcacggcggcaatattaccaaatgggtgctaatgggcggtgcgattggcggt
ctgtgtggattgctggggtttgtggcaccagcaacgtcgggcggcggttttaacctgatt
cctatcgctaccgcggggaatttcagcatgggaatgctggtgtttatcttcgtcgcgcgg
gtcattaccaccttactctgcttctcttccggcgcgccgggcggtatttttgccccgatg
ctggcgctgggtactgtgctgggaaccgctttcggaatggttgccgttgagctgtttccg
caatatcaccttgaggcggggacgtttgctattgccggaatgggggcattactggcggca
tctattcgcgcgccgttaacggggatcattctggttctggagatgaccgataactaccag
ctcattttgccaatgattattaccggtcttggcgcaacactattagcgcaatttaccggc
gggaaaccgctatactcggcgattcttgcgcgcacgctggcaaaacaggaagctgagcaa
ctggcgcgaagcaaggccgcatcagccagcgagaatacttga

DBGET integrated database retrieval system