KEGG   Escherichia coli K-12 MG1655: b0156Help
Entry
b0156             CDS       T00007                                 

Gene name
erpA
Definition
(RefSeq) iron-sulfur cluster insertion protein
  KO
K15724  
iron-sulfur cluster insertion protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
176610..176954
Genome map
AA seq 114 aa AA seqDB search
MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDM
TIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgacgtagcactgccgctggagtttaccgacgcagcagccaacaaagttaaa
agcctgatcgctgacgaagataacccgaatctgaaattacgcgtgtatatcaccggtggc
ggttgcagcggcttccagtatggtttcacctttgatgatcaggtgaacgaaggcgatatg
accatcgaaaaacagggcgttggcctggtggttgatccgatgagcctgcaatatctggtc
ggcggttccgttgattataccgaaggtctggaaggttctcgtttcatcgtgaccaacccg
aacgcgaaaagcacctgcggttgcggttcttcctttagtatctaa

DBGET integrated database retrieval system