KEGG   Escherichia coli K-12 MG1655: b0159Help
Entry
b0159             CDS       T00007                                 

Gene name
mtn
Definition
(RefSeq) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00270  Cysteine and methionine metabolism
eco01100  Metabolic pathways
eco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    b0159 (mtn)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     b0159 (mtn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 948542
NCBI-ProteinID: NP_414701
Pasteur: pfs
RegulonDB: ECK120001078
ECOCYC: EG11090
ASAP: ABE-0000545
UniProt: P0AF12
Structure
PDB: 

Jmol
Position
complement(178455..179153)
Genome map
AA seq 232 aa AA seqDB search
MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT
LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK
ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH
VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggcatcattggtgcaatggaagaagaagttacgctgctgcgtgacaaaatc
gaaaaccgtcaaactatcagtctcggcggttgcgaaatctataccggccaactgaatgga
accgaggttgcgcttctgaaatcgggcatcggtaaagtcgctgcggcgctgggtgccact
ttgctgttggaacactgcaagccagatgtgattattaacaccggttctgccggtggcctg
gcaccaacgttgaaagtgggcgatatcgttgtctcggacgaagcacgttatcacgacgcg
gatgtcacggcatttggttatgaatacggtcagttaccaggctgtccggcaggctttaaa
gctgacgataaactgatcgctgccgctgaggcctgcattgccgaactgaatcttaacgct
gtacgtggcctgattgttagcggcgacgctttcatcaacggttctgttggtctggcgaaa
atccgccacaacttcccacaggccattgctgtagagatggaagcgacggcaatcgcccat
gtctgccacaatttcaacgtcccgtttgttgtcgtacgcgccatctccgacgtggccgat
caacagtctcatcttagcttcgatgagttcctggctgttgccgctaaacagtccagcctg
atggttgagtcactggtgcagaaacttgcacatggctaa

DBGET integrated database retrieval system