KEGG   Escherichia coli K-12 MG1655: b0159Help
Entry
b0159             CDS       T00007                                 

Gene name
mtn
Definition
(RefSeq) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K01243  
adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    b0159 (mtn)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    b0159 (mtn)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     b0159 (mtn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(178455..179153)
Genome map
AA seq 232 aa AA seqDB search
MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT
LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK
ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH
VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggcatcattggtgcaatggaagaagaagttacgctgctgcgtgacaaaatc
gaaaaccgtcaaactatcagtctcggcggttgcgaaatctataccggccaactgaatgga
accgaggttgcgcttctgaaatcgggcatcggtaaagtcgctgcggcgctgggtgccact
ttgctgttggaacactgcaagccagatgtgattattaacaccggttctgccggtggcctg
gcaccaacgttgaaagtgggcgatatcgttgtctcggacgaagcacgttatcacgacgcg
gatgtcacggcatttggttatgaatacggtcagttaccaggctgtccggcaggctttaaa
gctgacgataaactgatcgctgccgctgaggcctgcattgccgaactgaatcttaacgct
gtacgtggcctgattgttagcggcgacgctttcatcaacggttctgttggtctggcgaaa
atccgccacaacttcccacaggccattgctgtagagatggaagcgacggcaatcgcccat
gtctgccacaatttcaacgtcccgtttgttgtcgtacgcgccatctccgacgtggccgat
caacagtctcatcttagcttcgatgagttcctggctgttgccgctaaacagtccagcctg
atggttgagtcactggtgcagaaacttgcacatggctaa

DBGET integrated database retrieval system