KEGG   Escherichia coli K-12 MG1655: b0161Help
Entry
b0161             CDS       T00007                                 

Gene name
degP
Definition
(RefSeq) serine endoprotease (protease Do), membrane-associated (EC:3.4.21.-)
  KO
K04771  
serine protease Do [EC:3.4.21.107]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Module
Cationic antimicrobial peptide (CAMP) resistance, envelope protein folding and degrading  factors DegP and DsbA
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b0161 (degP)
 Human Diseases
  Antimicrobial resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b0161 (degP)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     b0161 (degP)
Peptidases [BR:eco01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   b0161 (degP)
Chaperones and folding catalysts [BR:eco03110]
 Other chaperones and cochaperones
  DegP / HtrA
   b0161 (degP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
180884..182308
Genome map
AA seq 474 aa AA seqDB search
MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGS
TTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIID
ADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMAD
SDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGAL
VNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNS
ELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVG
SKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGT
PAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccacattagcactgagtgcactggctctgagtttaggtttggcgttatct
ccgctctctgcaacggcggctgagacttcttcagcaacgacagcccagcagatgccaagc
cttgcaccgatgctcgaaaaggtgatgccttcagtggtcagcattaacgtagaaggtagc
acaaccgttaatacgccgcgtatgccgcgtaatttccagcagttcttcggtgatgattct
ccgttctgccaggaaggttctccgttccagagctctccgttctgccagggtggccagggc
ggtaatggtggcggccagcaacagaaattcatggcgctgggttccggcgtcatcattgat
gccgataaaggctatgtcgtcaccaacaaccacgttgttgataacgcgacggtcattaaa
gttcaactgagcgatggccgtaagttcgacgcgaagatggttggcaaagatccgcgctct
gatatcgcgctgatccaaatccagaacccgaaaaacctgaccgcaattaagatggcggat
tctgatgcactgcgcgtgggtgattacaccgtagcgattggtaacccgtttggtctgggc
gagacggtaacttccgggattgtctctgcgctggggcgtagcggcctgaatgccgaaaac
tacgaaaacttcatccagaccgatgcagcgatcaaccgtggtaactccggtggtgcgctg
gttaacctgaacggcgaactgatcggtatcaacaccgcgatcctcgcaccggacggcggc
aacatcggtatcggttttgctatcccgagtaacatggtgaaaaacctgacctcgcagatg
gtggaatacggccaggtgaaacgcggtgagctgggtattatggggactgagctgaactcc
gaactggcgaaagcgatgaaagttgacgcccagcgcggtgctttcgtaagccaggttctg
cctaattcctccgctgcaaaagcgggcattaaagcgggtgatgtgatcacctcactgaac
ggtaagccgatcagcagctttgccgcactgcgtgctcaggtgggtactatgccggtaggc
agcaaactgaccctgggcttactgcgcgacggtaagcaggttaacgtgaacctggaactg
cagcagagcagccagaatcaggttgattccagctccatcttcaacggcattgaaggcgct
gagatgagcaacaaaggcaaagatcagggcgtggtagtgaacaacgtgaaaacgggcact
ccggctgcgcagatcggcctgaagaaaggtgatgtgattattggcgcgaaccagcaggca
gtgaaaaacatcgctgaactgcgtaaagttctcgacagcaaaccgtctgtgctggcactc
aacattcagcgcggcgacagcaccatctacctgttaatgcagtaa

DBGET integrated database retrieval system