KEGG   Escherichia coli K-12 MG1655: b0168Help
Entry
b0168             CDS       T00007                                 

Gene name
map
Definition
(RefSeq) methionine aminopeptidase (EC:3.4.11.18)
  KO
K01265  
methionyl aminopeptidase [EC:3.4.11.18]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     b0168 (map)
Peptidases [BR:eco01002]
 Metallo Peptidases
  Family M24
   b0168 (map)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(188712..189506)
Genome map
AA seq 264 aa AA seqDB search
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL
GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI
MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHDE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctatctcaatcaagaccccagaagatatcgaaaaaatgcgcgtcgctggccgactg
gctgccgaagtgctggagatgatcgaaccgtatgttaaaccgggcgtcagcaccggcgag
ctggatcgcatctgtaatgattacattgttaatgaacaacacgcggtttctgcctgcctc
ggctatcacggctatccgaaatccgtttgcatctctattaatgaagtggtgtgccacggt
atcccggacgatgctaagctgctgaaagatggcgatatcgttaacattgatgtcaccgta
atcaaagatggtttccacggcgatacctcgaaaatgtttatcgtcggtaagccgaccatc
atgggcgaacgtctgtgccgcatcacgcaagaaagcctgtacctggcgctacgcatggta
aaaccaggcattaatctgcgcgaaatcggtgcggcgattcagaaatttgtcgaagcagaa
ggcttctccgtcgttcgtgaatattgcggacacggtattggtcgcggcttccatgaagaa
ccgcaggtgctgcactatgactcccgtgaaaccaacgtcgtactgaaacctgggatgacg
ttcaccatcgagccaatggtcaacgcgggtaaaaaagagatccgcaccatgaaagatggc
tggacggtaaaaaccaaagatcgcagcttgtctgcacaatatgagcatactattgtggtg
actgataacggctgcgaaattctgacgctacgcaaggatgacaccatcccggcgataatc
tcgcacgacgaataa

DBGET integrated database retrieval system