KEGG   Escherichia coli K-12 MG1655: b0170Help
Entry
b0170             CDS       T00007                                 

Gene name
tsf
Definition
(RefSeq) translation elongation factor EF-Ts
  KO
K02357  
elongation factor Ts
Organism
eco  Escherichia coli K-12 MG1655
Brite
Translation factors [BR:eco03012]
 Eukaryotic Type
  Elongation factors
   b0170 (tsf)
 Prokaryotic Type
   b0170 (tsf)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    b0170 (tsf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
190857..191708
Genome map
AA seq 283 aa AA seqDB search
MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADG
VIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERV
ALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEF
IKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSK
TVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattaccgcatccctggtaaaagagctgcgtgagcgtactggcgcaggcatg
atggattgcaaaaaagcactgactgaagctaacggcgacatcgagctggcaatcgaaaac
atgcgtaagtccggtgctattaaagcagcgaaaaaagcaggcaacgttgctgctgacggc
gtgatcaaaaccaaaatcgacggcaactacggcatcattctggaagttaactgccagact
gacttcgttgcaaaagacgctggtttccaggcgttcgcagacaaagttctggacgcagct
gttgctggcaaaatcactgacgttgaagttctgaaagcacagttcgaagaagaacgtgtt
gcgctggtagcgaaaattggtgaaaacatcaacattcgccgcgttgctgcgctggaaggc
gacgttctgggttcttatcagcacggtgcgcgtatcggcgttctggttgctgctaaaggc
gctgacgaagagctggttaaacacatcgctatgcacgttgctgcaagcaagccagaattc
atcaaaccggaagacgtatccgctgaagtggtagaaaaagaataccaggtacagctggat
atcgcgatgcagtctggtaagccgaaagaaatcgcagagaaaatggttgaaggccgcatg
aagaaattcaccggcgaagtttctctgaccggtcagccgttcgttatggaaccaagcaaa
actgttggtcagctgctgaaagagcataacgctgaagtgactggcttcatccgcttcgaa
gtgggtgaaggcatcgagaaagttgagactgactttgcagcagaagttgctgcgatgtcc
aagcagtcttaa

DBGET integrated database retrieval system