KEGG   Escherichia coli K-12 MG1655: b0172Help
Entry
b0172             CDS       T00007                                 

Gene name
frr
Definition
(RefSeq) ribosome recycling factor
  KO
K02838  
ribosome recycling factor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Translation factors [BR:eco03012]
 Eukaryotic Type
  Release factors
   b0172 (frr)
 Prokaryotic Type
   b0172 (frr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
192872..193429
Genome map
AA seq 185 aa AA seqDB search
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVE
DSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGE
AEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEA
ELMQF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgattagcgatatcagaaaagatgctgaagtacgcatggacaaatgcgtagaagcgttc
aaaacccaaatcagcaaaatacgcacgggtcgtgcttctcccagcctgctggatggcatt
gtcgtggaatattacggcacgccgacgccgctgcgtcagctggcaagcgtaacggtagaa
gattcccgtacactgaaaatcaacgtgtttgatcgttcaatgtctccggccgttgaaaaa
gcgattatggcgtccgatcttggcctgaacccgaactctgcgggtagcgacatccgtgtt
ccgctgccgccgctgacggaagaacgtcgtaaagatctgaccaaaatcgttcgtggtgaa
gcagaacaagcgcgtgttgcagtacgtaacgtgcgtcgtgacgcgaacgacaaagtgaaa
gcactgttgaaagataaagagatcagcgaagacgacgatcgccgttctcaggacgatgta
cagaaactgactgatgctgcaatcaagaaaattgaagcggcgctggcagacaaagaagca
gaactgatgcagttctga

DBGET integrated database retrieval system