KEGG   Escherichia coli K-12 MG1655: b0176Help
Entry
b0176             CDS       T00007                                 

Gene name
rseP
Definition
(RefSeq) inner membrane zinc RIP metalloprotease; RpoE activator, by degrading RseA; cleaved signal peptide endoprotease
  KO
K11749  
regulator of sigma E protease [EC:3.4.24.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:eco00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b0176 (rseP)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     b0176 (rseP)
Peptidases [BR:eco01002]
 Metallo Peptidases
  Family M50: S2P protease family
   b0176 (rseP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
196546..197898
Genome map
AA seq 450 aa AA seqDB search
MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYV
IALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVF
IIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTI
TVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL
QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIG
FVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG
PISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPVLDGGHLLFLAIEKIKGGPVS
ERVQDFCYRIGSILLVLLMGLALFNDFSRL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgctgagttttctctgggatttggcttcgttcatcgttgcactgggtgtacttatcacc
gtgcatgaatttggtcatttctgggttgcccggcgttgtggtgttcgcgttgagcgtttc
tcaatagggtttggtaaggcgctctggcggcgaactgataagctcggcaccgaatatgtt
atcgccctgatcccgttgggcggttatgtcaaaatgctggatgagcgcgcagaaccggtc
gttccggaactccgccaccatgccttcaataataaatctgtcggccaacgagcggcgatt
attgccgcaggtccggttgcaaacttcatttttgctatctttgcctactggctggttttt
attattggtgtgcctggcgtacgtccggtggttggcgaaatagcagccaattcgatagct
gcggaagcacaaattgcaccaggtacggaactaaaagccgtagatggtatcgaaacgcct
gattgggatgccgtgcgtttgcagttggtcgataaaattggcgatgaaagcaccaccatt
acagtagcgccatttggcagcgaccaacggcgggatgtaaagctcgatttacgtcactgg
gcgtttgagcctgataaagaagatccggtatcttcgctggggattcgtcctcgtgggccg
caaattgaacctgtactggaaaatgtgcagccaaactcggcggcaagcaaggcaggtttg
caagcaggcgacaggatcgttaaagtcgatggtcagcccttaacgcagtgggtgaccttt
gtgatgcttgtccgggataacccgggtaaatccttagcgttagaaatcgaaaggcagggg
agtcccttgtctttgacattaatcccggagagtaaaccgggtaatggtaaagcgattggt
tttgtcggtattgagccgaaagtcattcctttgccagatgagtataaagttgtacgccag
tatgggccgttcaacgccatcgtcgaagccacggacaaaacgtggcagctgatgaagctg
acggtcagtatgctgggaaaattgatcaccggtgatgtgaaactgaacaacctcagtggg
ccgatctctatcgccaagggggctgggatgacagcggaactcggggttgtttattacctg
ccgtttcttgcgcttattagcgtgaacttagggataattaacctgtttccgttgcccgta
cttgacggggggcatctgctgttccttgcgatcgaaaagatcaagggcggaccggtatcc
gagcgggttcaagacttttgttatcgcattggctcgattctgctggtgctgttaatgggg
cttgcacttttcaatgatttctctcggttatga

DBGET integrated database retrieval system