KEGG   Escherichia coli K-12 MG1655: b0177Help
Entry
b0177             CDS       T00007                                 

Gene name
bamA
Definition
(RefSeq) BamABCDE complex OM biogenesis outer membrane pore-forming assembly factor
  KO
K07277  
outer membrane protein insertion porin family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial protein import machinery
  Outer membrane
   TOB/SAM complex
    b0177 (bamA)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0177 (bamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
197928..200360
Genome map
AA seq 810 aa AA seqDB search
MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS
NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR
VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI
NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI
DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK
VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS
KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE
RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV
DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ
PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT
IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTV
RGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFIT
PTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPL
GPLVFSYAQPFKKYDGDKAEQFQFNIGKTW
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaaaagttgctcatagcgtcgctgctgtttagcagcgccaccgtatacggt
gctgaagggttcgtagtgaaagatattcatttcgaaggccttcagcgtgtcgccgttggt
gcggccctcctcagtatgccggtgcgcacaggcgacacggttaatgatgaagatatcagt
aataccattcgcgctctgtttgctaccggcaactttgaggatgttcgcgtccttcgtgat
ggtgatacccttctggttcaggtaaaagaacgtccgaccattgccagcattactttctcc
ggtaacaaatcggtgaaagatgacatgctgaagcaaaacctcgaggcttctggtgtgcgt
gtgggcgaatccctcgatcgcaccaccattgccgatatcgagaaaggtctggaagacttc
tactacagcgtcggtaaatatagcgccagcgtaaaagctgtcgtgaccccgctgccgcgc
aaccgtgttgacctaaaactggtgttccaggaaggtgtgtcagctgaaatccagcaaatt
aacattgttggtaaccatgctttcaccaccgacgaactgatctctcatttccaactgcgt
gacgaagtgccgtggtggaacgtggtaggcgatcgtaaataccagaaacagaaactggcg
ggcgaccttgaaaccctgcgcagctactatctggatcgcggttatgcccgtttcaacatc
gactctacccaggtcagtctgacgccagataaaaaaggtatttacgtcacggtgaacatc
accgaaggcgatcagtacaagctttctggcgttgaagtgagcggcaaccttgccgggcac
tccgctgaaattgagcagctgactaagatcgagccgggtgagctgtataacggcaccaaa
gtgaccaagatggaagatgacatcaaaaagcttctcggtcgctatggttatgcctatccg
cgcgtacagtcgatgcccgaaattaacgatgccgacaaaaccgttaaattacgtgtgaac
gttgatgcgggtaaccgtttctacgtgcgtaagatccgttttgaaggtaacgatacctcg
aaagatgccgtcctgcgtcgcgaaatgcgtcagatggaaggtgcatggctggggagcgat
ctggtcgatcagggtaaggagcgtctgaatcgtctgggcttctttgaaactgtcgatacc
gatacccaacgtgttccgggtagcccggaccaggttgatgtcgtctacaaggtaaaagag
cgcaacaccggtagcttcaactttggtattggttacggtactgaaagtggcgtgagcttc
caggctggtgtgcagcaggataactggttaggtacaggttatgctgttggtatcaacggg
accaaaaacgattaccagacctatgctgaactgtcggtaaccaacccgtacttcaccgta
gatggcgtaagcctcggtggtcgtctcttctataatgacttccaggcagatgacgccgac
ctgtccgactataccaacaagagttatggtacagacgtgacgttgggcttcccgattaac
gaatataactcgctgcgtgcaggtctgggttatgtacataactccctgtccaacatgcag
cctcaggttgcgatgtggcgttatctgtactctatgggtgaacatccgagcacctctgat
caggataacagcttcaaaacggacgacttcacgttcaactatggttggacctataacaag
cttgaccgtggttacttcccgacagatggttcacgtgtcaacctgaccggtaaagtgacc
attcctggatcggataacgaatactacaaagtgacgttagacacggcgacttatgtgccg
atcgatgacgatcacaaatgggttgttctggggcgtacccgctggggttatggtgatggt
ttaggcggcaaagagatgccgttctacgagaacttctatgccggtggttccagcaccgtg
cgtggcttccagtccaataccattggtccgaaagcagtttacttcccgcatcaggccagt
aattatgatccggactatgattacgaatgtgcgactcaggacggcgcgaaagacctgtgt
aaatcggatgatgctgtaggcggtaacgccatggcggttgccagcctcgagttcatcacc
ccgacgccgtttattagcgataagtatgctaactcggttcgtacttccttcttctgggat
atgggtaccgtttgggatacaaactgggattccagccaatattctggatatccggactat
agtgatccaagcaatatccgtatgtctgcgggtatcgcattacaatggatgtccccattg
gggccgttggtgttctcctacgcccagccgttcaaaaagtacgatggagacaaggcagaa
cagttccagtttaacatcggtaaaacctggtaa

DBGET integrated database retrieval system