KEGG   Escherichia coli K-12 MG1655: b0179Help
Entry
b0179             CDS       T00007                                 

Gene name
lpxD
Definition
(RefSeq) UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase (EC:2.3.1.-)
  KO
K02536  
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    b0179 (lpxD)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     b0179 (lpxD)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Lipid A
  b0179 (lpxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
200971..201996
Genome map
AA seq 341 aa AA seqDB search
MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVV
MTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGA
NAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGA
DGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHN
VVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGV
YSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaattcgactggctgatttagcgcagcagttggatgcagaactacacggtgat
ggcgatatcgtcatcaccggcgttgcgtccatgcaatctgcacaaacaggtcacattacg
ttcatggttaacccaaaataccgtgagcatttaggcttgtgccaggcgtccgcggttgtc
atgacccaggacgatcttcctttcgcgaaaagtgccgcactggtagtgaagaatccctac
ctgacttacgcgcgcatggcgcaaattttagataccacgccgcagcccgcgcagaacatt
gcacccagtgcggtgatcgacgcgacggcgaagctgggtaacaacgtatcgattggcgct
aacgcggtgattgagtccggcgttgaactgggcgataacgtgattatcggtgccggttgc
ttcgtaggtaaaaacagcaaaatcggtgcaggttcgcgtctctgggcgaacgtaaccatt
taccatgagatccagatcggtcagaattgcctgatccagtccggaacagtggtaggcgca
gacggctttggttatgccaacgatcgtggtaactgggtgaagatcccacagattggtcgc
gtaattattggcgatcgcgtggagatcggtgcctgcacaaccatcgatcgcggcgcgctg
gatgacactattattggcaatggcgtgatcattgataaccagtgccagattgcacataac
gtcgtgattggcgacaatacggcggttgccggtggcgtcattatggcgggcagcctgaaa
attggtcgttactgcatgatcggcggagccagcgtaatcaacgggcatatggaaatatgc
gacaaagtgacggttacgggcatgggtatggtgatgcgtcccatcactgaaccaggcgtc
tattcctcaggcattccgctgcaacccaacaaagtctggcgcaaaaccgctgcactggtg
atgaacattgatgacatgagcaagcgtctgaaatcgcttgagcgcaaggttaatcaacaa
gactaa

DBGET integrated database retrieval system