KEGG   Escherichia coli K-12 MG1655: b0186Help
Entry
b0186             CDS       T00007                                 

Gene name
ldcC
Definition
(RefSeq) lysine decarboxylase 2, constitutive (EC:4.1.1.18)
  KO
K01582  
lysine decarboxylase [EC:4.1.1.18]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    b0186 (ldcC)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.18  lysine decarboxylase
     b0186 (ldcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
209679..211820
Genome map
AA seq 713 aa AA seqDB search
MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKFIEHNPRICGVIFDWD
EYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALWFFEYALGQAEDIAIRMRQY
TDEYLDNITPPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPVGCLFYDFFGGNTLKADV
SISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTSTSNKIVGMYAAPSGSTLLI
DRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFTRDSIEEKVAATTQAQWPVH
AVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFHPIYQGKSGMSGERVAGKVIF
ETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTTSPSYPIVASVETAAAMLRGNP
GKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQVDEAECWPVAPGEQWHGFNDAD
ADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKFLDERGIVVEKTGPYNLLFLFSIG
IDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAEDPDFYRNMRIQDLAQGIHKLIRKH
DLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETIALEQLVGRVSANMILPYPPGVPLLM
PGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIHGAKQDEDGVYRVRVLKMAG
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcattgccattatgggaccgcatggcgtcttttataaagatgagcccatcaaa
gaactggagtcggcgctggtggcgcaaggctttcagattatctggccacaaaacagcgtt
gatttgctgaaatttatcgagcataaccctcgaatttgcggcgtgatttttgactgggat
gagtacagtctcgatttatgtagcgatatcaatcagcttaatgaatatctcccgctttat
gccttcatcaacacccactcgacgatggatgtcagcgtgcaggatatgcggatggcgctc
tggttttttgaatatgcgctggggcaggcggaagatatcgccattcgtatgcgtcagtac
accgacgaatatcttgataacattacaccgccgttcacgaaagccttgtttacctacgtc
aaagagcggaagtacaccttttgtacgccggggcatatgggcggcaccgcatatcaaaaa
agcccggttggctgtctgttttatgattttttcggcgggaatactcttaaggctgatgtc
tctatttcggtcaccgagcttggttcgttgctcgaccacaccgggccacacctggaagcg
gaagagtacatcgcgcggacttttggcgcggaacagagttatatcgttaccaacggaaca
tcgacgtcgaacaaaattgtgggtatgtacgccgcgccatccggcagtacgctgttgatc
gaccgcaattgtcataaatcgctggcgcatctgttgatgatgaacgatgtagtgccagtc
tggctgaaaccgacgcgtaatgcgttggggattcttggtgggatcccgcgccgtgaattt
actcgcgacagcatcgaagagaaagtcgctgctaccacgcaagcacaatggccggttcat
gcggtgatcaccaactccacctatgatggcttgctctacaacaccgactggatcaaacag
acgctggatgtcccgtcgattcacttcgattctgcctgggtgccgtacacccattttcat
ccgatctaccagggtaaaagtggtatgagcggcgagcgtgttgcgggaaaagtgatcttc
gaaacgcaatcgacccacaaaatgctggcggcgttatcgcaggcttcgctgatccacatt
aaaggcgagtatgacgaagaggcctttaacgaagcctttatgatgcataccaccacctcg
cccagttatcccattgttgcttcggttgagacggcggcggcgatgctgcgtggtaatccg
ggcaaacggctgattaaccgttcagtagaacgagctctgcattttcgcaaagaggtccag
cggctgcgggaagagtctgacggttggtttttcgatatctggcaaccgccgcaggtggat
gaagccgaatgctggcccgttgcgcctggcgaacagtggcacggctttaacgatgcggat
gccgatcatatgtttctcgatccggttaaagtcactattttgacaccggggatggacgag
cagggcaatatgagcgaggaggggatcccggcggcgctggtagcaaaattcctcgacgaa
cgtgggatcgtagtagagaaaaccggcccttataacctgctgtttctctttagtattggc
atcgataaaaccaaagcaatgggattattgcgtgggttgacggaattcaaacgctcttac
gatctcaacctgcggatcaaaaatatgctacccgatctctatgcagaagatcccgatttc
taccgcaatatgcgtattcaggatctggcacaagggatccataagctgattcgtaaacac
gatcttcccggtttgatgttgcgggcattcgatactttgccggagatgatcatgacgcca
catcaggcatggcaacgacaaattaaaggcgaagtagaaaccattgcgctggaacaactg
gtcggtagagtatcggcaaatatgatcctgccttatccaccgggcgtaccgctgttgatg
cctggagaaatgctgaccaaagagagccgcacagtactcgattttctactgatgctttgt
tccgtcgggcaacattaccccggttttgaaacggatattcacggcgcgaaacaggacgaa
gacggcgtttaccgcgtacgagtcctaaaaatggcgggataa

DBGET integrated database retrieval system