KEGG   Escherichia coli K-12 MG1655: b0198Help
Entry
b0198             CDS       T00007                                 

Gene name
metI
Definition
(RefSeq) DL-methionine transporter subunit
  KO
K02072  
D-methionine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0198 (metI)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    b0198 (metI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(220968..221621)
Genome map
AA seq 217 aa AA seqDB search
MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIV
NIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLI
EASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYG
YIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagccgatgatgtggctgctggttcgtggcgtatgggaaacgctggcaatgacc
ttcgtatccggtttttttggctttgtgattggtctgccggttggcgttctgctttatgtc
acgcgtccggggcaaattattgctaacgcgaagctgtatcgtaccgtttctgcgattgtg
aacattttccgttccatcccgttcattatcttgcttgtatggatgattccgtttacccgc
gttattgtcggtacatcgattggtttgcaggcagcgattgttccgttaaccgttggtgca
gcaccgtttattgcccgtatggtcgagaacgctctgctggagatcccaaccgggttaatt
gaagcttcccgcgcaatgggtgccacgccgatgcagatcgtccgtaaggtgctgttaccg
gaagcgctgccgggtctggtgaatgcggcaactatcaccctgattaccctggtcggttat
tccgcgatgggtggtgcagtcggtgccggtggtttaggtcagattggctatcagtatggc
tacatcggctataacgcgacggtgatgaatacggtactggtattgctggtcattctggtt
tatttaattcagttcgcaggcgaccgcatcgtccgggctgtcactcgcaagtaa

DBGET integrated database retrieval system