KEGG   Escherichia coli K-12 MG1655: b0199Help
Entry
b0199             CDS       T00007                                 

Gene name
metN
Definition
(RefSeq) DL-methionine transporter subunit
  KO
K02071  
D-methionine transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0199 (metN)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    b0199 (metN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(221614..222645)
Genome map
AA seq 343 aa AA seqDB search
MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG
SVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRR
VTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSIL
ELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKF
IQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQ
MDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVLGYV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactttcgaatatcaccaaagtgttccaccagggcacccgcaccatccaggcg
ttgaacaacgtcagcctgcatgtgccagctggacaaatttatggcgttatcggtgcctca
ggcgcgggtaagagtacgcttatacgttgtgtaaacctgctggagcgcccaaccgagggt
agcgtgctggtcgatggccaggaactgaccacgctgtcagaatccgagttgaccaaagct
cgccgccagattggtatgattttccagcattttaacctgctctcttcgcgtactgttttt
ggcaacgtggctctgccgctggagctggacaacacaccgaaagacgaggtcaaacgtcgc
gtgacggaattgctgtcattggttggtcttggcgataagcatgatagctacccgtcgaat
ctttccggtgggcagaaacaacgtgtggcaattgcccgtgcgttagccagcaatcccaaa
gtattgctgtgtgatgaagccaccagcgcgctggacccggcaacgacacgttctattctc
gaactgctgaaagacatcaaccgccgtctggggttgacgattctgttgatcacccacgaa
atggacgttgtgaagcgcatttgtgattgcgtggcggtcatcagcaatggagaactgatc
gagcaggacacggtaagtgaagtgttctcgcatccgaaaacgccgctggcgcagaagttt
attcagtcgaccctgcatctggatatcccggaagattaccaggaacgtctgcaagcggag
ccatttactgactgcgtgccgatgctgcgtctggagtttaccggtcaatcggtcgatgcc
ccactgctttctgaaaccgcgcgtcgtttcaacgtcaacaacaacattattagcgcgcag
atggattacgccggtggcgttaagttcggcatcatgctgactgaaatgcacggcacacaa
caagatacgcaagccgccattgcctggctgcaggaacaccatgtaaaagtagaggtactg
ggttatgtctga

DBGET integrated database retrieval system