KEGG   Escherichia coli K-12 MG1655: b0219Help
Entry
b0219             CDS       T00007                                 

Gene name
yafV
Definition
(RefSeq) putative NAD(P)-binding C-N hydrolase family amidase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(239419..240189)
Genome map
AA seq 256 aa AA seqDB search
MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFTSGFAMEAAASSLAQD
DVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHFYDKRHLFRMADEHLHY
KAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLALYVANWPAPRSLHWQALLTAR
AIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADAHQATRIDAELSMAALREY
REKFPAWQDADEFRLW
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcctggtttgaagattacgcttttgcagcaaccactggtgtggatggatggtcctgcc
aacctgcgtcattttgatcgtcaactggaaggtattaccgggcgcgatgtgatcgttcta
ccggagatgtttaccagcggctttgccatggaagcggcagcttcgtcgctagcacaagat
gacgtagtgaactggatgacagctaaggcgcagcagtgcaatgcgctgattgcaggcagt
gttgcattacaaacggagtctggttcggttaaccgctttttgctggttgagccgggcggc
acggtacatttttatgataagcgtcatctgttccgcatggcagatgagcatctacattat
aaagcgggcaatgcgcgagtgattgtggaatggcgcggctggcgtattttgccgctggtg
tgctacgacttacgttttcctgtgtggtcgcgcaatctcaacgattatgacctcgccctg
tacgtcgccaactggcctgctccgcgctctctgcactggcaggcattgctgacggcccgc
gcgattgagaatcaggcgtatgtggcgggatgcaatcgcgtcggcagcgatggcaacggc
tgccattatcgcggtgacagccgggtgattaatccgcaaggagagattatcgctactgcc
gacgcgcatcaggcaacgcgcattgatgcggagctgtcgatggcagcattgcgggaatat
agagaaaagtttccggcatggcaggatgcggatgagtttaggttgtggtga

DBGET integrated database retrieval system