KEGG   Escherichia coli K-12 MG1655: b0219Help
Entry
b0219             CDS       T00007                                 

Gene name
yafV
Definition
(RefSeq) putative NAD(P)-binding C-N hydrolase family amidase
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00250  Alanine, aspartate and glutamate metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b0219 (yafV)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     b0219 (yafV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 946585
NCBI-ProteinID: NP_414754
Pasteur: yafV
RegulonDB: ECK120002723
ECOCYC: G6103
ASAP: ABE-0000734
UniProt: Q47679
Position
complement(239419..240189)
Genome map
AA seq 256 aa AA seqDB search
MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFTSGFAMEAAASSLAQD
DVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHFYDKRHLFRMADEHLHY
KAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLALYVANWPAPRSLHWQALLTAR
AIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADAHQATRIDAELSMAALREY
REKFPAWQDADEFRLW
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcctggtttgaagattacgcttttgcagcaaccactggtgtggatggatggtcctgcc
aacctgcgtcattttgatcgtcaactggaaggtattaccgggcgcgatgtgatcgttcta
ccggagatgtttaccagcggctttgccatggaagcggcagcttcgtcgctagcacaagat
gacgtagtgaactggatgacagctaaggcgcagcagtgcaatgcgctgattgcaggcagt
gttgcattacaaacggagtctggttcggttaaccgctttttgctggttgagccgggcggc
acggtacatttttatgataagcgtcatctgttccgcatggcagatgagcatctacattat
aaagcgggcaatgcgcgagtgattgtggaatggcgcggctggcgtattttgccgctggtg
tgctacgacttacgttttcctgtgtggtcgcgcaatctcaacgattatgacctcgccctg
tacgtcgccaactggcctgctccgcgctctctgcactggcaggcattgctgacggcccgc
gcgattgagaatcaggcgtatgtggcgggatgcaatcgcgtcggcagcgatggcaacggc
tgccattatcgcggtgacagccgggtgattaatccgcaaggagagattatcgctactgcc
gacgcgcatcaggcaacgcgcattgatgcggagctgtcgatggcagcattgcgggaatat
agagaaaagtttccggcatggcaggatgcggatgagtttaggttgtggtga

DBGET integrated database retrieval system