KEGG   Escherichia coli K-12 MG1655: b0222Help
Entry
b0222             CDS       T00007                                 

Gene name
gmhA
Definition
(RefSeq) D-sedoheptulose 7-phosphate isomerase (EC:5.-.-.-)
  KO
K03271  
D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    b0222 (gmhA)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.28  D-sedoheptulose 7-phosphate isomerase
     b0222 (gmhA)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Unusual sugar
  b0222 (gmhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
243543..244121
Genome map
AA seq 192 aa AA seqDB search
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRYVEAVGREGDVLLGIST
SGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggatcttattcgtaacgaactgaacgaagcggcggaaacgctggctaacttt
ttaaaagatgacgccaatattcacgccattcagcgcgcggcggtcctgttagcagacagc
tttaaagccggtggcaaagtgctttcctgcggcaacggcggttcccattgcgacgctatg
cactttgccgaagagttgaccggtcgctaccgtgaaaaccgtccgggctacccggcgatt
gctatttctgacgttagtcatatttcctgcgtcggtaatgatttcggtttcaatgatatt
ttctcccgctacgttgaagcggtaggtcgcgaaggcgatgtactgctggggatctccacc
tccggtaactctgcaaacgtgatcaaagcgatcgcagcggcgcgtgagaagggaatgaaa
gtgatcaccctgaccggtaaagacggcggcaaaatggctggcacggcggatatcgaaatt
cgcgtaccgcactttggttatgccgaccgcattcaggagattcacattaaagtgatccat
atcctgatccagttgattgaaaaagagatggttaagtaa

DBGET integrated database retrieval system