KEGG   Escherichia coli K-12 MG1655: b0224Help
Entry
b0224             CDS       T00007                                 

Gene name
yafK
Definition
(RefSeq) L,D-transpeptidase-related protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(245065..245805)
Genome map
AA seq 246 aa AA seqDB search
MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVK
MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAINIGFPNA
YDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALVFGQPSVQVSIYPFRMTD
ANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKPLSHEVVQPQLASNY
TLPEAK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaatcgcattaattcttgcgatgttgttgatcccgtgcgtttcatttgccggt
ttgctgggcagcagtagctctaccacgcctgtgagcaaagagtataagcagcagttgatg
ggatcccctgtctacatccagatcttcaaggaagaacgtacgctcgatctctacgtcaaa
atgggcgagcaatatcaactgctcgacagctataaaatctgtaaatattccggcggctta
gggccaaaacagcgtcagggcgatttcaaaagcccggaagggttttatagcgtccagcgt
aatcagttaaaaccagacagccgttactacaaagcgattaatattggtttccccaatgcc
tatgaccgtgcgcatggttatgaagggaaatacctgatgatccacggcgattgtgtttcc
atcggctgctacgcaatgaccaatcagggtattgatgagatattccagttcgttactggt
gcgctggtgtttggtcagccgagcgtgcaagtgagtatttacccgttccgcatgaccgac
gccaatatgaagcgccataaatattccaactttaaggacttctgggagcaactgaagccg
ggttacgactactttgagcaaacccgtaagccaccaaccgtttctgtggtcaatggtcgt
tacgtggtcagcaagccgttaagccacgaagttgtgcagccacaactggcatcaaactac
acgctccccgaggcaaaataa

DBGET integrated database retrieval system