KEGG   Escherichia coli K-12 MG1655: b0227Help
Entry
b0227             CDS       T00007                                 

Gene name
yafL
Definition
(RefSeq) putative lipoprotein and C40 family peptidase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
246712..247461
Genome map
AA seq 249 aa AA seqDB search
MSLPSIPSFVLSGLLLICLPFSSFASATTSHISFSYAARQRMQNRARLLKQYQTHLKKQA
SYIVEGNAESKRALRQHNREQIKQHPEWFPAPLKASDRRWQALAENNHFLSSDHLHNITE
VAIHRLEQQLGKPYVWGGTRPDKGFDCSGLVFYAYNKILEAKLPRTANEMYHYRRATIVA
NNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIESPRTGETIRISRLAEPFWQDHFLGAR
RILTEETIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgccgtcgattccatcctttgtattgtcgggattactgttgatttgtttgccg
ttttcttcatttgccagcgccaccacatcacatatctctttcagctacgccgcccgccag
cggatgcaaaaccgtgcgcgtttattaaaacagtaccaaactcatctgaaaaagcaggcc
agctatattgtggaaggcaatgccgaaagcaaaagggcgctacgccagcacaaccgggag
cagataaaacagcatccagaatggtttcctgctccgctcaaggcgagtgacagacgctgg
caggcgctggcggaaaacaaccactttttaagcagcgaccatctgcataacattaccgaa
gtggcgattcaccgcctggagcagcagcttggcaagccttacgtctggggcggtacgcgg
cctgataaaggctttgactgtagcgggttggttttttatgcctacaacaagatccttgag
gctaagctcccgcgcacggccaatgagatgtaccactatcgccgggcaacgattgtggcg
aacaacgacctgcgccggggagatttgctgtttttccatatccacagccgcgagatagcc
gatcatatgggcgtgtatttgggcgatgggcaatttatcgagtcgccacgtaccggcgaa
accattcggataagccgattagccgaacctttctggcaggaccattttttgggcgcgcgc
aggattttgacggaagagacgattttgtag

DBGET integrated database retrieval system