KEGG   Escherichia coli K-12 MG1655: b0238Help
Entry
b0238             CDS       T00007                                 

Gene name
gpt
Definition
(RefSeq) xanthine phosphoribosyltransferase; xanthine-guanine phosphoribosyltransferase (EC:2.4.2.22)
  KO
K00769  
xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b0238 (gpt)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     b0238 (gpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
255977..256435
Genome map
AA seq 152 aa AA seqDB search
MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI
SSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRP
LVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaatacatcgtcacctgggacatgttgcagatccatgcacgtaaactcgca
agccgactgatgccttctgaacaatggaaaggcattattgccgtaagccgtggcggtctg
gtaccgggtgcgttactggcgcgtgaactgggtattcgtcatgtcgataccgtttgtatt
tccagctacgatcacgacaaccagcgcgagcttaaagtgctgaaacgcgcagaaggcgat
ggcgaaggcttcatcgttattgatgacctggtggataccggtggtactgcggttgcgatt
cgtgaaatgtatccaaaagcgcactttgtcaccatcttcgcaaaaccggctggtcgtccg
ctggttgatgactatgttgttgatatcccgcaagatacctggattgaacagccgtgggat
atgggcgtcgtattcgtcccgccaatctccggtcgctaa

DBGET integrated database retrieval system